T0455

X-ray Targets
387 388 389 390
391 392 393 394
395 396 397 398
399 400 401 402
403 404 405 406
407 408 409 410
411 412 413 414
415 416 417 418
419 420 421 422
423 424 425 426
427 428 429 430
431 432 433 434
435 436 438 439
440 441 442 443
444 445 446 447
448 449 450 451
452 453 454 455
456 457 458 459
461 463 465 470
477 478 479 481
483 485 486 487
488 489 490 491
493 494 495 496
497 501 502 503
504 505 506 507
508 509 510 511
512 513 514

T0455

GntR family transcriptional regulator (APC85201) from Enterococcus faecalis V583

Target type: Server only

Target sequence:

>T0455 APC85201, transcriptional regulator, Enterococcus faecalis V583, 145 residues
SQNRVPSSRTVSYFVAKPSSSEMEKLQLGPEDSILRMERIRFADDIPICFEVASIPYSLVSQYGKSEITNSFYKTLEAKSGHKIGHSNQTISAVQASEQIAEYLEIKRGDAILRVRQVSYFENGLPFEYVRTQYAGSRFEFYLEK

Structure:
Method: X-ray, res=2.65Å, R/Rfree=0.21/0.25
Determined by: MCSG
PDB ID: 3ddv

3ddv_A cartoon
Cartoon diagram of 455: 3ddv chain A

PyMOL of 3ddv

Domains:  PyMOL of domains

Single domain protein, but a duplication. Ranges for the duplicates are 3-60 and 83-145, with a long disordered region in between.

455 domain evaluation plot
Correlation between weighted by the number of residues sum of GDT-TS scores for domain-based evlatuation (y, vertical axis) and whole chain GDT-TS (x, horizontal axis).

To compute the weighted sum, GDT-TS for each domain was multiplied by the domain length, and this sum was divided by the sum of domain lengths. Each point represents first server model. Green, gray and black points are top 10, bottom 25% and the rest of prediction models. Blue line is the best-fit slope line (intersection 0) to the top 10 server models. Red line is the diagonal. Slope and root mean square y-x distance for the top 10 models (average difference between the weighted sum of domain GDT-TS scores and the whole chain GDT-TS score) are shown above the plot.

Structure classification:

Chorismate lyase fold.

CASP category:

Whole chain: Comparative modeling:easy.

1st domain: Comparative modeling:easy. 2nd domain: Comparative modeling:easy.

Closest templates:

2fa1.

Target sequence - PDB file inconsistencies:

T0455    3ddv.pdb    T0455.pdb    PyMOL    PyMOL of domains    

T0455    1 SQNRVPSSRTVSYFVAKPSSSEMEKLQLGPEDSILRMERIRFADDIPICFEVASIPYSLVSQYGKSEITNSFYKTLEAKSGHKIGHSNQTISAVQASEQIAEYLEIKRGDAILRVRQVSYFENGLPFEYVRTQYAGSRFEFYLEK 145
           ~~||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~~~~~~~~~~~~~~~~|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3ddvA    3 --NRVPSSRTVSYFVAKPSSSEMEKLQLGPEDSILRMERIRFADDIPICFEVASIPYSLV----------------------KIGHSNQTISAVQASEQIAEYLEIKRGDAILRVRQVSYFENGLPFEYVRTQYAGSRFEFYLEK 145

We suggest to evaluate this target as a single domain spanning whole chain. However, evolutionarily this is a 2-domain protein:

1st domain: target 3-60 ; pdb 3-60

2nd domain: target 83-145 ; pdb 83-145

Sequence classification:

UTRA domain in Pfam.

Server predictions:

T0455:pdb 3-145:seq 3-145:CM_easy;   alignment

distribution of first scores
First models for T0455: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

455_1:pdb 3-60:seq 3-60:CM_easy;   alignment

distribution of first scores
First models for T0455_1: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

455_2:pdb 83-145:seq 83-145:CM_easy;   alignment

distribution of first scores
First models for T0455_2: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

# GROUP ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ ↓ GROUP #
T0455 455_1 455_2 T0455 455_1 455_2 T0455 455_1 455_2 T0455 455_1 455_2
First score First Z-score Best score Best Z-score
1 fais−server 85.74 84.64 87.80 87.93 85.63 88.31 87.30 83.86 88.37 2.53 3.08 0.05 0.70 0.92 -0.05 2.06 2.25 0.18 85.74 84.64 92.82 90.09 89.22 95.97 89.68 87.83 89.94 2.06 2.41 0.83 0.92 1.28 1.02 2.48 2.72 0.22 fais−server 1
2 Fiser−M4T 84.09 80.92 87.91 86.21 76.15 88.92 86.91 84.79 88.08 2.10 2.38 0.07 0.33 -0.74 0.04 1.95 2.46 0.12 84.09 80.92 87.91 86.21 76.15 88.92 86.91 84.79 88.08 1.51 1.62 -0.61 -0.56 -2.06 -1.02 1.45 1.89 -0.61 Fiser−M4T 2
3 PSI 83.26 76.52 86.28 83.62 80.46 85.21 87.70 81.88 88.06 1.88 1.56 -0.23 -0.23 0.01 -0.52 2.17 1.81 0.11 83.26 76.52 89.84 89.22 84.63 92.39 87.70 81.88 90.00 1.23 0.68 -0.04 0.59 0.10 -0.02 1.74 1.08 0.25 PSI 3
4 LEE−SERVER 81.82 73.83 92.68 90.09 88.94 95.84 84.13 78.31 90.05 1.50 1.06 0.95 1.17 1.50 1.09 1.15 1.02 0.53 82.64 78.65 92.68 90.09 88.94 95.84 85.32 79.23 90.15 1.03 1.14 0.79 0.92 1.21 0.98 0.85 0.35 0.32 LEE−SERVER 4
5 Zhang−Server 81.20 76.79 90.45 90.52 89.08 91.29 83.73 79.23 89.91 1.34 1.61 0.54 1.26 1.52 0.40 1.04 1.22 0.50 81.82 77.41 90.70 90.95 90.09 91.66 84.13 79.89 90.30 0.76 0.87 0.21 1.25 1.50 -0.23 0.40 0.54 0.38 Zhang−Server 5
6 panther_server 80.37 78.31 82.74 81.90 69.25 79.91 84.92 80.95 86.48 1.12 1.89 -0.89 -0.60 -1.94 -1.32 1.38 1.61 -0.22 80.37 78.31 85.87 84.91 81.47 86.75 84.92 80.95 88.36 0.27 1.06 -1.21 -1.06 -0.70 -1.65 0.70 0.83 -0.48 panther_server 6
7 HHpred5 79.75 73.28 92.80 87.93 84.48 94.94 85.71 78.84 91.34 0.96 0.95 0.97 0.70 0.72 0.95 1.60 1.14 0.80 79.75 73.28 92.80 87.93 84.48 94.94 85.71 78.84 91.34 0.07 -0.01 0.82 0.10 0.07 0.72 1.00 0.25 0.85 HHpred5 7
8 PS2−server 79.55 74.17 92.30 90.09 87.79 94.52 81.75 77.51 90.27 0.90 1.12 0.88 1.17 1.29 0.89 0.47 0.84 0.58 81.41 78.38 92.30 90.09 87.79 94.52 83.73 78.70 90.27 0.62 1.08 0.68 0.92 0.91 0.60 0.25 0.21 0.37 PS2−server 8
9 MUProt 79.34 73.83 92.36 89.22 87.50 95.23 82.94 77.12 90.00 0.85 1.06 0.89 0.98 1.24 0.99 0.81 0.75 0.52 79.34 73.83 92.36 89.22 87.50 95.23 82.94 77.12 90.07 -0.07 0.11 0.69 0.59 0.84 0.81 -0.04 -0.23 0.28 MUProt 9
10 COMA−M 79.34 72.31 91.35 92.24 90.52 95.00 80.56 74.21 88.20 0.85 0.77 0.70 1.64 1.77 0.96 0.13 0.11 0.14 85.54 78.10 91.70 95.26 90.81 95.00 89.68 85.98 89.74 1.99 1.02 0.50 2.90 1.68 0.74 2.48 2.21 0.13 COMA−M 10
11 FAMSD 79.13 71.28 91.56 89.66 87.64 93.32 80.16 74.60 90.07 0.79 0.58 0.74 1.08 1.27 0.71 0.01 0.20 0.54 79.34 72.31 91.65 89.66 87.64 94.05 80.95 75.66 90.07 -0.07 -0.21 0.49 0.76 0.87 0.46 -0.79 -0.63 0.28 FAMSD 11
12 FEIG 79.13 69.90 92.13 89.22 85.49 94.69 79.36 73.55 89.71 0.79 0.32 0.85 0.98 0.89 0.91 -0.22 -0.04 0.46 85.95 83.33 92.13 90.52 89.66 94.69 86.91 85.58 89.71 2.13 2.13 0.63 1.09 1.39 0.65 1.45 2.10 0.12 FEIG 12
13 Phyre_de_novo 78.72 73.48 91.91 88.79 87.64 93.95 83.33 76.85 90.21 0.69 0.99 0.81 0.89 1.27 0.80 0.92 0.69 0.57 84.30 79.34 91.91 88.79 87.64 93.95 87.70 84.52 90.21 1.58 1.28 0.56 0.42 0.87 0.44 1.74 1.81 0.34 Phyre_de_novo 13
14 MULTICOM−REFINE 78.72 72.80 92.06 87.93 86.21 94.70 81.75 77.51 89.89 0.69 0.87 0.83 0.70 1.02 0.91 0.47 0.84 0.50 79.75 73.69 92.27 89.22 87.21 95.13 82.54 77.51 90.03 0.07 0.08 0.67 0.59 0.76 0.78 -0.19 -0.12 0.26 MULTICOM−REFINE 14
15 YASARA 78.72 71.01 84.08 90.09 86.35 91.31 81.35 70.77 76.60 0.69 0.53 -0.64 1.17 1.04 0.40 0.35 -0.66 -2.29 78.72 71.01 92.60 90.09 86.35 94.48 82.14 77.12 90.82 -0.28 -0.49 0.76 0.92 0.54 0.59 -0.34 -0.23 0.62 YASARA 15
16 BAKER−ROBETTA 78.51 71.07 92.48 88.36 82.33 94.92 79.36 74.07 90.20 0.63 0.54 0.91 0.80 0.34 0.95 -0.22 0.08 0.56 78.51 71.07 92.48 88.79 86.21 94.92 79.36 74.07 90.22 -0.35 -0.48 0.73 0.42 0.51 0.72 -1.38 -1.07 0.35 BAKER−ROBETTA 16
17 FUGUE_KM 78.51 69.22 87.33 85.78 82.04 89.69 81.35 71.56 86.44 0.63 0.20 -0.04 0.24 0.29 0.16 0.35 -0.48 -0.22 81.41 79.75 90.68 85.78 82.04 90.97 85.32 82.41 90.22 0.62 1.37 0.20 -0.73 -0.56 -0.43 0.85 1.23 0.35 FUGUE_KM 17
18 MULTICOM−CLUSTER 78.31 71.97 91.94 87.93 85.63 94.44 82.14 75.79 89.71 0.58 0.71 0.81 0.70 0.92 0.87 0.58 0.46 0.46 80.58 75.89 92.30 88.79 86.78 94.82 83.73 77.38 90.38 0.34 0.55 0.68 0.42 0.65 0.69 0.25 -0.16 0.42 MULTICOM−CLUSTER 18
19 HHpred4 78.31 71.97 92.99 90.09 88.36 95.79 80.56 74.47 90.42 0.58 0.71 1.01 1.17 1.39 1.08 0.13 0.17 0.61 78.31 71.97 92.99 90.09 88.36 95.79 80.56 74.47 90.42 -0.41 -0.28 0.88 0.92 1.06 0.97 -0.93 -0.96 0.44 HHpred4 19
20 HHpred2 78.31 71.97 92.99 90.09 88.36 95.79 80.56 74.47 90.42 0.58 0.71 1.01 1.17 1.39 1.08 0.13 0.17 0.61 78.31 71.97 92.99 90.09 88.36 95.79 80.56 74.47 90.42 -0.41 -0.28 0.88 0.92 1.06 0.97 -0.93 -0.96 0.44 HHpred2 20
21 MUSTER 78.31 71.42 93.05 89.22 81.75 95.66 81.35 76.32 90.96 0.58 0.61 1.02 0.98 0.24 1.06 0.35 0.58 0.72 80.17 76.31 93.05 89.22 86.92 95.66 84.52 77.12 90.96 0.21 0.64 0.90 0.59 0.69 0.93 0.55 -0.23 0.68 MUSTER 21
22 3D−JIGSAW_V3 78.31 70.18 92.64 87.93 84.48 93.99 81.75 77.51 91.40 0.58 0.38 0.94 0.70 0.72 0.81 0.47 0.84 0.81 79.13 72.11 93.16 89.22 86.92 95.41 81.75 77.51 91.40 -0.14 -0.25 0.93 0.59 0.69 0.86 -0.49 -0.12 0.87 3D−JIGSAW_V3 22
23 3DShot2 78.31 70.04 81.29 82.76 72.99 84.94 84.13 74.73 79.92 0.58 0.35 -1.15 -0.42 -1.29 -0.56 1.15 0.22 -1.59 78.31 70.04 81.29 82.76 72.99 84.94 84.13 74.73 79.92 -0.41 -0.69 -2.55 -1.88 -2.87 -2.17 0.40 -0.89 -4.25 3DShot2 23
24 keasar−server 78.10 70.66 92.57 88.79 84.77 95.22 80.16 73.81 90.14 0.52 0.47 0.93 0.89 0.77 0.99 0.01 0.02 0.55 79.34 71.07 92.98 88.79 84.77 95.84 82.14 75.40 90.34 -0.07 -0.48 0.88 0.42 0.14 0.98 -0.34 -0.70 0.40 keasar−server 24
25 Pcons_multi 78.10 70.66 92.79 88.79 83.05 95.50 79.76 74.21 90.49 0.52 0.47 0.97 0.89 0.47 1.03 -0.10 0.11 0.62 78.10 70.66 92.79 88.79 85.49 95.50 80.56 74.34 90.51 -0.48 -0.56 0.82 0.42 0.32 0.88 -0.93 -0.99 0.48 Pcons_multi 25
26 pipe_int 78.10 69.97 91.83 87.50 84.05 93.48 79.36 71.96 90.22 0.52 0.34 0.79 0.61 0.64 0.73 -0.22 -0.39 0.57 78.51 69.97 91.83 88.79 84.05 93.48 83.73 75.53 90.22 -0.35 -0.71 0.54 0.42 -0.04 0.30 0.25 -0.66 0.35 pipe_int 26
27 pro−sp3−TASSER 77.89 68.87 90.66 87.93 87.93 90.73 81.75 76.19 90.55 0.47 0.13 0.58 0.70 1.32 0.31 0.47 0.55 0.64 78.31 71.56 91.59 87.93 87.93 92.42 83.73 80.03 90.83 -0.41 -0.37 0.47 0.10 0.95 -0.01 0.25 0.57 0.62 pro−sp3−TASSER 27
28 forecast 77.69 70.52 92.22 88.79 83.05 94.45 79.36 72.75 90.14 0.42 0.44 0.86 0.89 0.47 0.88 -0.22 -0.22 0.55 81.61 75.69 92.28 89.22 86.35 94.45 83.73 76.19 90.53 0.69 0.51 0.67 0.59 0.54 0.58 0.25 -0.48 0.49 forecast 28
29 SAM−T06−server 77.48 71.01 87.18 84.91 80.89 88.84 78.97 74.73 86.51 0.36 0.53 -0.07 0.05 0.09 0.03 -0.33 0.22 -0.21 77.48 71.01 87.18 85.34 81.90 88.94 80.16 75.66 89.20 -0.69 -0.49 -0.82 -0.89 -0.59 -1.01 -1.08 -0.63 -0.11 SAM−T06−server 29
30 MULTICOM−RANK 77.48 69.35 92.34 87.50 84.91 94.82 81.75 75.40 90.31 0.36 0.22 0.89 0.61 0.79 0.93 0.47 0.37 0.59 83.26 81.61 92.34 88.79 86.49 94.98 82.54 79.89 90.31 1.23 1.76 0.69 0.42 0.58 0.73 -0.19 0.54 0.39 MULTICOM−RANK 30
31 Pushchino 77.48 67.97 90.52 86.21 79.31 90.61 79.36 71.96 90.22 0.36 -0.04 0.55 0.33 -0.19 0.30 -0.22 -0.39 0.57 77.48 67.97 90.52 86.21 79.31 90.61 79.36 71.96 90.22 -0.69 -1.13 0.16 -0.56 -1.25 -0.53 -1.38 -1.65 0.35 Pushchino 31
32 MULTICOM−CMFR 77.27 70.52 92.03 87.07 83.91 94.34 80.56 71.30 90.15 0.30 0.44 0.83 0.52 0.62 0.86 0.13 -0.54 0.55 79.75 72.86 92.28 89.22 86.64 94.45 82.94 76.59 90.47 0.07 -0.09 0.67 0.59 0.62 0.58 -0.04 -0.37 0.46 MULTICOM−CMFR 32
33 3D−JIGSAW_AEP 77.27 69.83 93.34 89.22 86.35 95.41 79.36 74.07 91.48 0.30 0.31 1.07 0.98 1.04 1.02 -0.22 0.08 0.83 78.93 72.04 93.34 90.09 87.21 95.49 81.75 76.72 91.48 -0.21 -0.27 0.98 0.92 0.76 0.88 -0.49 -0.34 0.91 3D−JIGSAW_AEP 33
34 SAM−T02−server 77.27 67.97 86.69 85.78 82.04 89.69 79.36 75.40 85.11 0.30 -0.04 -0.16 0.24 0.29 0.16 -0.22 0.37 -0.50 82.03 80.37 87.29 85.78 82.61 90.36 86.91 84.26 87.56 0.83 1.50 -0.79 -0.73 -0.41 -0.60 1.45 1.74 -0.84 SAM−T02−server 34
35 METATASSER 77.07 70.87 89.62 85.78 81.18 90.29 81.75 75.93 88.94 0.25 0.50 0.38 0.24 0.14 0.25 0.47 0.49 0.30 78.31 72.93 89.62 88.36 88.36 90.29 82.94 77.38 90.48 -0.41 -0.08 -0.11 0.26 1.06 -0.62 -0.04 -0.16 0.46 METATASSER 35
36 GS−KudlatyPred 77.07 69.63 92.40 87.50 79.74 95.38 77.78 71.43 89.67 0.25 0.27 0.90 0.61 -0.11 1.02 -0.67 -0.51 0.45 78.72 70.73 92.40 89.22 86.35 95.38 79.36 71.69 89.89 -0.28 -0.55 0.71 0.59 0.54 0.85 -1.38 -1.72 0.20 GS−KudlatyPred 36
37 GS−MetaServer2 77.07 69.35 91.43 86.21 80.75 92.62 79.76 72.35 90.20 0.25 0.22 0.72 0.33 0.06 0.60 -0.10 -0.30 0.56 78.93 70.59 91.43 86.21 81.47 92.62 80.95 72.35 90.20 -0.21 -0.58 0.42 -0.56 -0.70 0.05 -0.79 -1.54 0.34 GS−MetaServer2 37
38 GeneSilicoMetaServer 77.07 69.35 91.43 86.21 80.75 92.62 79.76 72.35 90.20 0.25 0.22 0.72 0.33 0.06 0.60 -0.10 -0.30 0.56 79.13 71.42 91.75 87.93 84.63 93.25 80.95 75.13 90.20 -0.14 -0.40 0.52 0.10 0.10 0.23 -0.79 -0.77 0.34 GeneSilicoMetaServer 38
39 Pcons_dot_net 76.86 69.28 91.20 84.48 79.60 92.84 80.56 73.68 89.68 0.20 0.21 0.67 -0.04 -0.14 0.63 0.13 -0.01 0.45 79.55 73.21 91.98 87.93 84.19 94.53 84.13 77.91 89.74 -0.00 -0.02 0.58 0.10 -0.01 0.60 0.40 -0.01 0.13 Pcons_dot_net 39
40 SAM−T08−server 76.03 68.32 90.27 89.22 85.49 95.44 74.60 69.58 86.44 -0.02 0.03 0.50 0.98 0.89 1.03 -1.58 -0.92 -0.22 78.31 71.14 92.33 89.22 85.92 95.44 79.36 72.62 89.78 -0.41 -0.46 0.69 0.59 0.43 0.87 -1.38 -1.47 0.15 SAM−T08−server 40
41 3Dpro 75.83 66.46 89.27 80.60 75.43 89.36 83.73 79.23 89.92 -0.07 -0.32 0.32 -0.88 -0.87 0.11 1.04 1.22 0.50 75.83 67.70 89.73 84.91 81.47 89.83 83.73 79.23 90.10 -1.24 -1.19 -0.08 -1.06 -0.70 -0.76 0.25 0.35 0.29 3Dpro 41
42 RAPTOR 75.21 66.94 92.57 86.21 81.61 95.30 75.79 68.39 90.05 -0.24 -0.23 0.93 0.33 0.21 1.00 -1.24 -1.18 0.53 79.34 72.73 92.58 90.52 88.22 95.52 84.52 79.76 90.61 -0.07 -0.12 0.76 1.09 1.02 0.89 0.55 0.50 0.52 RAPTOR 42
43 CpHModels 74.38 64.74 78.08 84.48 81.61 86.35 77.38 71.83 70.27 -0.46 -0.64 -1.75 -0.04 0.21 -0.35 -0.78 -0.42 -3.61 74.38 64.74 78.08 84.48 81.61 86.35 77.38 71.83 70.27 -1.72 -1.82 -3.49 -1.22 -0.67 -1.76 -2.13 -1.68 -8.56 CpHModels 43
44 Frankenstein 74.17 66.32 91.19 87.50 78.88 94.01 82.14 77.65 90.10 -0.51 -0.34 0.67 0.61 -0.26 0.81 0.58 0.87 0.54 83.68 74.72 92.58 92.24 90.81 95.77 82.94 78.44 90.10 1.37 0.30 0.76 1.74 1.68 0.96 -0.04 0.14 0.29 Frankenstein 44
45 rehtnap 74.17 64.94 83.44 80.17 73.85 79.14 76.59 71.30 87.32 -0.51 -0.60 -0.76 -0.98 -1.14 -1.43 -1.01 -0.54 -0.04 74.17 64.94 87.66 82.33 78.02 86.92 76.59 71.30 88.44 -1.79 -1.78 -0.68 -2.05 -1.58 -1.60 -2.42 -1.83 -0.45 rehtnap 45
46 Pcons_local 73.76 65.08 84.10 78.02 73.42 78.79 84.13 74.34 89.74 -0.62 -0.58 -0.63 -1.44 -1.22 -1.49 1.15 0.14 0.47 82.44 79.68 86.92 87.93 85.06 90.68 84.13 81.48 89.74 0.96 1.35 -0.90 0.10 0.21 -0.51 0.40 0.97 0.13 Pcons_local 46
47 mGenTHREADER 73.35 64.39 79.95 79.74 76.87 82.06 75.79 68.92 78.44 -0.73 -0.71 -1.40 -1.07 -0.61 -0.99 -1.24 -1.07 -1.90 73.35 64.39 79.95 79.74 76.87 82.06 75.79 68.92 78.44 -2.07 -1.89 -2.94 -3.04 -1.88 -3.00 -2.72 -2.49 -4.91 mGenTHREADER 47
48 Poing 73.35 64.12 82.21 79.74 76.87 82.06 74.21 65.48 84.01 -0.73 -0.76 -0.98 -1.07 -0.61 -0.99 -1.69 -1.83 -0.73 84.30 79.34 91.27 87.93 85.63 94.49 87.70 84.52 89.65 1.58 1.28 0.37 0.10 0.36 0.59 1.74 1.81 0.09 Poing 48
49 Phyre2 73.35 64.12 82.21 79.74 76.87 82.06 74.21 65.48 84.01 -0.73 -0.76 -0.98 -1.07 -0.61 -0.99 -1.69 -1.83 -0.73 84.30 79.34 91.35 87.93 83.05 94.67 87.70 84.52 89.65 1.58 1.28 0.40 0.10 -0.30 0.64 1.74 1.81 0.09 Phyre2 49
50 Phragment 73.35 64.12 82.21 79.74 76.87 82.06 74.21 65.48 84.01 -0.73 -0.76 -0.98 -1.07 -0.61 -0.99 -1.69 -1.83 -0.73 84.30 79.34 91.54 88.36 83.19 95.09 87.70 84.52 89.65 1.58 1.28 0.45 0.26 -0.26 0.76 1.74 1.81 0.09 Phragment 50
51 Distill 72.93 68.11 79.64 81.90 81.03 81.36 76.19 72.22 80.59 -0.84 -0.01 -1.46 -0.60 0.11 -1.10 -1.12 -0.33 -1.45 74.79 71.49 79.64 82.33 82.33 81.36 78.57 75.40 80.59 -1.59 -0.39 -3.03 -2.05 -0.48 -3.20 -1.68 -0.70 -3.95 Distill 51
52 ACOMPMOD 72.93 62.33 81.64 79.31 76.72 82.32 74.60 65.34 81.61 -0.84 -1.09 -1.09 -1.16 -0.64 -0.95 -1.58 -1.86 -1.24 77.69 69.49 85.52 86.64 84.05 91.49 82.54 76.85 86.65 -0.62 -0.81 -1.31 -0.40 -0.04 -0.28 -0.19 -0.30 -1.25 ACOMPMOD 52
53 BioSerf 71.69 61.36 80.75 78.45 75.29 82.22 75.00 65.48 79.92 -1.16 -1.27 -1.25 -1.35 -0.89 -0.97 -1.47 -1.83 -1.59 71.69 61.36 80.75 78.45 75.29 82.22 75.00 65.48 79.92 -2.62 -2.54 -2.70 -3.53 -2.28 -2.95 -3.02 -3.43 -4.25 BioSerf 53
54 MUFOLD−Server 71.49 61.57 84.69 78.45 72.99 79.59 81.35 76.06 90.20 -1.22 -1.23 -0.53 -1.35 -1.29 -1.37 0.35 0.52 0.56 78.93 70.25 84.85 88.36 85.49 91.93 83.73 77.91 90.20 -0.21 -0.65 -1.50 0.26 0.32 -0.15 0.25 -0.01 0.34 MUFOLD−Server 54
55 OLGAFS 70.87 62.05 68.30 68.97 66.67 64.36 81.35 71.56 86.44 -1.38 -1.14 -3.55 -3.40 -2.40 -3.66 0.35 -0.48 -0.22 79.96 78.03 83.09 85.34 81.32 90.36 83.73 80.29 90.06 0.14 1.00 -2.02 -0.89 -0.74 -0.60 0.25 0.65 0.28 OLGAFS 55
56 FFASstandard 70.45 59.57 83.71 76.72 71.55 77.96 82.14 77.91 89.59 -1.49 -1.61 -0.71 -1.72 -1.54 -1.61 0.58 0.93 0.44 81.61 75.96 87.13 86.64 82.33 89.69 82.14 78.97 89.65 0.69 0.56 -0.84 -0.40 -0.48 -0.80 -0.34 0.28 0.09 FFASstandard 56
57 circle 70.25 61.43 83.28 78.45 70.98 77.72 82.94 77.65 88.98 -1.54 -1.26 -0.79 -1.35 -1.64 -1.65 0.81 0.87 0.31 74.38 66.25 89.78 86.21 80.75 92.16 82.94 77.65 89.08 -1.72 -1.50 -0.06 -0.56 -0.89 -0.08 -0.04 -0.08 -0.16 circle 57
58 COMA 70.04 59.99 83.91 75.43 70.55 78.36 81.35 70.24 89.79 -1.60 -1.53 -0.67 -2.00 -1.72 -1.55 0.35 -0.77 0.48 78.93 69.01 91.70 90.52 77.01 95.00 84.52 78.70 89.79 -0.21 -0.91 0.50 1.09 -1.84 0.74 0.55 0.21 0.16 COMA 58
59 FFASsuboptimal 69.83 60.19 82.95 76.72 72.41 76.64 80.95 76.45 89.33 -1.65 -1.49 -0.85 -1.72 -1.39 -1.81 0.24 0.61 0.38 70.45 60.74 84.40 77.59 73.56 79.47 82.14 77.91 89.65 -3.03 -2.67 -1.64 -3.86 -2.72 -3.75 -0.34 -0.01 0.09 FFASsuboptimal 59
60 FFASflextemplate 69.63 60.40 83.63 76.72 71.55 77.78 80.56 76.06 89.65 -1.71 -1.45 -0.72 -1.72 -1.54 -1.64 0.13 0.52 0.45 69.63 61.09 83.63 76.72 71.55 77.78 80.95 76.45 89.65 -3.31 -2.60 -1.86 -4.19 -3.24 -4.24 -0.79 -0.41 0.09 FFASflextemplate 60
61 nFOLD3 68.59 57.58 84.66 77.59 70.11 80.20 78.97 72.88 89.83 -1.98 -1.98 -0.53 -1.53 -1.79 -1.27 -0.33 -0.19 0.49 76.45 68.66 91.82 85.34 81.32 93.98 82.54 77.25 90.06 -1.03 -0.99 0.54 -0.89 -0.74 0.44 -0.19 -0.19 0.28 nFOLD3 61
62 LOOPP_Server 68.59 55.23 84.41 78.02 72.27 80.54 77.78 72.75 88.75 -1.98 -2.42 -0.58 -1.44 -1.42 -1.22 -0.67 -0.22 0.26 81.20 75.55 89.98 86.64 83.91 90.58 81.35 77.12 89.95 0.55 0.48 -0.00 -0.40 -0.08 -0.54 -0.64 -0.23 0.23 LOOPP_Server 62
63 FOLDpro 65.50 54.89 72.46 84.48 79.60 88.92 63.49 53.44 59.30 -2.79 -2.48 -2.78 -0.04 -0.14 0.04 -4.76 -4.50 -5.91 77.48 71.56 89.42 87.07 85.92 89.83 82.14 77.65 89.86 -0.69 -0.37 -0.17 -0.23 0.43 -0.76 -0.34 -0.08 0.19 FOLDpro 63
64 FALCON 63.64 54.41 63.47 69.40 65.37 68.41 66.67 56.75 67.53 -3.28 -2.57 -4.44 -3.31 -2.62 -3.05 -3.85 -3.77 -4.19 79.13 75.14 90.96 88.36 80.17 92.61 81.75 77.78 89.92 -0.14 0.39 0.28 0.26 -1.03 0.05 -0.49 -0.05 0.21 FALCON 64
65 FALCON_CONSENSUS 58.26 49.17 61.71 74.57 69.97 67.21 61.11 48.41 62.61 -4.70 -3.55 -4.76 -2.19 -1.82 -3.23 -5.44 -5.62 -5.22 75.41 66.32 83.64 88.36 76.29 92.61 81.35 73.41 88.94 -1.38 -1.48 -1.86 0.26 -2.03 0.05 -0.64 -1.25 -0.22 FALCON_CONSENSUS 65
66 MUFOLD−MD 32.23 25.62 48.74 60.34 47.13 72.48 37.70 33.99 45.70 -11.55 -7.95 -7.16 -5.27 -5.81 -2.44 -12.15 -8.82 -8.76 32.65 29.61 65.19 68.10 61.78 81.58 60.71 56.61 76.90 -15.62 -9.28 -7.26 -7.49 -5.73 -3.14 -8.37 -5.88 -5.60 MUFOLD−MD 66
67 RBO−Proteus 25.41 19.70 43.35 50.00 41.67 63.09 36.51 34.52 42.53 -13.35 -9.05 -8.15 -7.51 -6.76 -3.86 -12.49 -8.70 -9.43 34.71 30.10 63.81 71.55 62.36 83.76 63.49 53.44 75.15 -14.94 -9.18 -7.66 -6.17 -5.58 -2.51 -7.33 -6.75 -6.38 RBO−Proteus 67
68 RANDOM 16.54 14.34 16.54 24.98 21.44 24.98 23.22 20.08 23.22 -15.68 -10.05 -13.10 -12.92 -10.30 -9.61 -16.30 -11.91 -13.47 16.54 14.34 16.54 24.98 21.44 24.98 23.22 20.08 23.22 -20.99 -12.53 -21.49 -23.97 -16.04 -19.50 -22.42 -15.94 -29.57 RANDOM 68
69 schenk−torda−server 16.53 13.36 16.31 25.00 20.98 23.92 29.76 23.68 24.45 -15.69 -10.23 -13.14 -12.92 -10.38 -9.77 -14.43 -11.11 -13.22 16.53 13.36 19.10 25.00 20.98 26.18 29.76 23.68 30.70 -21.00 -12.74 -20.75 -23.96 -16.16 -19.15 -19.97 -14.95 -26.23 schenk−torda−server 69
70 mariner1 12.60 9.78 19.50 25.43 19.11 29.87 20.64 19.05 25.43 -16.72 -10.90 -12.55 -12.83 -10.71 -8.87 -17.04 -12.14 -13.01 16.53 14.39 27.61 32.76 29.74 39.05 28.97 24.34 33.55 -21.00 -12.52 -18.25 -21.00 -13.92 -15.43 -20.26 -14.76 -24.96 mariner1 70
71 mahmood−torda−server 11.98 8.13 17.42 21.98 16.24 24.88 20.24 18.65 25.85 -16.89 -11.21 -12.93 -13.57 -11.21 -9.62 -17.15 -12.23 -12.92 13.02 11.29 20.84 25.86 21.84 30.90 24.21 20.50 26.94 -22.16 -13.18 -20.24 -23.64 -15.94 -17.79 -22.05 -15.82 -27.91 mahmood−torda−server 71
72 BHAGEERATH                                                       -15.68 -10.05 -13.10 -12.92 -10.30 -9.61 -16.30 -11.91 -13.47                                                       -20.99 -12.53 -21.49 -23.97 -16.04 -19.50 -22.42 -15.94 -29.57 BHAGEERATH 72
73 huber−torda−server                                                       -15.68 -10.05 -13.10 -12.92 -10.30 -9.61 -16.30 -11.91 -13.47                                                       -20.99 -12.53 -21.49 -23.97 -16.04 -19.50 -22.42 -15.94 -29.57 huber−torda−server 73
74 test_http_server_01                                                       -15.68 -10.05 -13.10 -12.92 -10.30 -9.61 -16.30 -11.91 -13.47                                                       -20.99 -12.53 -21.49 -23.97 -16.04 -19.50 -22.42 -15.94 -29.57 test_http_server_01 74