T0412

X-ray Targets
387 388 389 390
391 392 393 394
395 396 397 398
399 400 401 402
403 404 405 406
407 408 409 410
411 412 413 414
415 416 417 418
419 420 421 422
423 424 425 426
427 428 429 430
431 432 433 434
435 436 438 439
440 441 442 443
444 445 446 447
448 449 450 451
452 453 454 455
456 457 458 459
461 463 465 470
477 478 479 481
483 485 486 487
488 489 490 491
493 494 495 496
497 501 502 503
504 505 506 507
508 509 510 511
512 513 514

T0412

ACIAD1822 effector domain of the putative transcriptional regulator IclR from Acinetobacter sp. ADP1

Target type: Server only

Target sequence:

>T0412 ACIAD1822 effector domain, Putative IclR, Acinetobacter sp. ADP1, 178 residues
SNALFSSRDILEVLQDIHMETGETVAIATKNDIYLQYIQIIESVHALRFHVDENAIRPLTMSSNGWMLMSTMNDKAIDNTVRRANTITQKDGIRFEVDDMMARIRQVREQGYASAEHIPFVGGGTICVLLPMTIQGQPVTMGLGGALDRIKQNYDRYLELLLNGVQQLKKSDSFHQPI

Structure:
Method: X-ray, res=2.46Å, R/Rfree=0.20/0.27
Determined by: MCSG
PDB ID: 3d3o

3d3o_A cartoon
Cartoon diagram of 412: 3d3o chain A

PyMOL of 3d3o

Domains:  PyMOL of domains

Single domain protein.

Structure classification:

Profilin fold. GAF domain superfamily.

CASP category:

Comparative modeling:medium.

Closest templates:

1mkm, 2g7u, 3bjn, 1ysp.

Target sequence - PDB file inconsistencies:

T0412    3d3o.pdb    T0412.pdb    PyMOL    PyMOL of domains    

T0412    1 SNALFSSRDILEVLQDIHMETGETVAIATKNDIYLQYIQIIESVHALRFHVDENAIRPLTMSSNGWMLMSTMNDKAIDNTVRRANTITQKDGIRFEVDDMMARIRQVREQGYASAEHIPFVGGGTICVLLPMTIQGQPVTMGLGGALDRIKQNYDRYLELLLNGVQQLKKSDSFHQPI 178
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~
3d3oA   -2 SNALFSSRDILEVLQDIHMETGETVAIATKNDIYLQYIQIIESVHALRFHVDENAIRPLTMSSNGWMLMSTMNDKAIDNTVRRANTITQKDGIRFEVDDMMARIRQVREQGYASAEHIPFVGGGTICVLLPMTIQGQPVTMGLGGALDRIKQNYDRYLELLLNGVQQLKKSDSFHQ-- 173

Residue change log: change 16, 58, 64, 66, 69, 97, 98, 129, 138, MSE to MET;

Single domain protein: target 1-176 ; pdb -2-173

Sequence classification:

Bacterial transcriptional regulator IclR in Pfam.

Server predictions:

T0412:pdb -2-173:seq 1-176:CM_medium;   alignment

distribution of first scores
First models for T0412: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

# GROUP ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ ↓ GROUP #
T0412 T0412 T0412 T0412
First score First Z-score Best score Best Z-score
1 SAM−T06−server 75.85 71.40 76.10 1.87 2.27 1.33 75.85 71.40 76.10 1.83 1.59 1.38 SAM−T06−server 1
2 MULTICOM−RANK 75.71 66.15 76.19 1.83 1.08 1.35 75.71 70.79 76.62 1.77 1.43 1.55 MULTICOM−RANK 2
3 MULTICOM−CLUSTER 75.71 66.15 76.19 1.83 1.08 1.35 75.71 67.61 76.28 1.77 0.56 1.44 MULTICOM−CLUSTER 3
4 3D−JIGSAW_V3 75.14 71.83 75.18 1.68 2.36 1.13 75.14 71.83 75.18 1.55 1.71 1.07 3D−JIGSAW_V3 4
5 MUProt 75.00 64.58 76.23 1.64 0.73 1.36 75.00 65.34 76.58 1.50 -0.06 1.54 MUProt 5
6 MULTICOM−REFINE 74.57 63.40 76.18 1.52 0.47 1.35 75.00 72.06 76.51 1.50 1.77 1.51 MULTICOM−REFINE 6
7 METATASSER 74.01 64.16 74.36 1.37 0.64 0.95 74.57 67.66 74.50 1.33 0.58 0.84 METATASSER 7
8 Phyre_de_novo 73.58 69.13 73.61 1.25 1.76 0.78 73.58 69.13 73.61 0.95 0.98 0.55 Phyre_de_novo 8
9 Pcons_multi 72.73 62.83 73.10 1.02 0.34 0.67 72.73 67.28 73.10 0.63 0.47 0.38 Pcons_multi 9
10 FFASstandard 72.30 60.65 71.47 0.90 -0.15 0.31 72.30 67.57 71.47 0.46 0.55 -0.17 FFASstandard 10
11 Frankenstein 72.16 62.50 72.87 0.87 0.26 0.62 72.87 65.20 73.15 0.68 -0.09 0.39 Frankenstein 11
12 RAPTOR 72.02 64.35 73.20 0.83 0.68 0.69 75.99 72.30 75.81 1.88 1.84 1.28 RAPTOR 12
13 pipe_int 72.02 63.97 71.38 0.83 0.59 0.30 72.02 67.23 73.67 0.36 0.46 0.57 pipe_int 13
14 SAM−T08−server 71.88 61.88 74.72 0.79 0.12 1.03 71.88 64.44 74.72 0.30 -0.30 0.92 SAM−T08−server 14
15 FFASflextemplate 71.59 68.47 67.58 0.71 1.61 -0.54 71.59 68.47 67.58 0.19 0.80 -1.47 FFASflextemplate 15
16 COMA−M 71.59 67.99 71.15 0.71 1.50 0.24 72.02 69.27 71.91 0.36 1.01 -0.02 COMA−M 16
17 Zhang−Server 71.45 61.13 76.37 0.67 -0.05 1.39 71.45 63.49 76.37 0.14 -0.56 1.47 Zhang−Server 17
18 pro−sp3−TASSER 71.31 64.82 73.47 0.63 0.79 0.75 71.31 64.82 74.20 0.08 -0.20 0.74 pro−sp3−TASSER 18
19 FFASsuboptimal 71.31 60.70 69.68 0.63 -0.14 -0.08 71.59 67.99 71.92 0.19 0.67 -0.02 FFASsuboptimal 19
20 BAKER−ROBETTA 71.17 64.82 70.30 0.60 0.79 0.06 71.17 64.82 70.30 0.03 -0.20 -0.56 BAKER−ROBETTA 20
21 LEE−SERVER 70.88 65.20 69.38 0.52 0.87 -0.14 71.45 66.71 71.35 0.14 0.32 -0.21 LEE−SERVER 21
22 panther_server 70.74 66.00 67.27 0.48 1.05 -0.60 72.58 68.61 71.05 0.57 0.83 -0.31 panther_server 22
23 MULTICOM−CMFR 70.60 65.20 72.54 0.44 0.87 0.55 70.60 65.20 73.18 -0.19 -0.09 0.40 MULTICOM−CMFR 23
24 PS2−server 70.60 62.36 72.83 0.44 0.23 0.61 74.01 69.08 74.12 1.12 0.96 0.72 PS2−server 24
25 3D−JIGSAW_AEP 70.03 66.43 69.44 0.28 1.15 -0.13 70.03 66.43 69.44 -0.41 0.24 -0.85 3D−JIGSAW_AEP 25
26 keasar−server 69.60 65.44 70.93 0.17 0.92 0.20 73.72 69.46 72.17 1.01 1.07 0.06 keasar−server 26
27 rehtnap 69.03 61.84 71.54 0.01 0.11 0.33 69.18 64.92 71.54 -0.74 -0.17 -0.15 rehtnap 27
28 Distill 68.89 62.93 61.39 -0.03 0.36 -1.89 68.89 62.93 61.39 -0.85 -0.71 -3.53 Distill 28
29 forecast 68.61 61.03 73.88 -0.10 -0.07 0.84 68.61 61.65 73.88 -0.95 -1.06 0.64 forecast 29
30 mGenTHREADER 68.47 61.55 73.87 -0.14 0.05 0.84 68.47 61.55 73.87 -1.01 -1.09 0.63 mGenTHREADER 30
31 Pcons_dot_net 68.32 61.51 69.80 -0.18 0.04 -0.05 72.30 68.89 71.55 0.46 0.91 -0.14 Pcons_dot_net 31
32 FAMSD 68.18 62.03 69.87 -0.22 0.16 -0.04 68.18 62.03 69.87 -1.12 -0.96 -0.70 FAMSD 32
33 GS−KudlatyPred 68.18 61.17 68.07 -0.22 -0.04 -0.43 69.89 63.07 71.93 -0.46 -0.67 -0.02 GS−KudlatyPred 33
34 BioSerf 68.18 60.70 74.42 -0.22 -0.14 0.96 68.18 60.70 74.42 -1.12 -1.32 0.82 BioSerf 34
35 MUSTER 68.04 62.26 71.37 -0.26 0.21 0.29 72.30 68.13 74.70 0.46 0.70 0.91 MUSTER 35
36 PSI 68.04 61.41 71.26 -0.26 0.02 0.27 71.31 65.86 71.26 0.08 0.09 -0.24 PSI 36
37 3DShot2 68.04 60.84 71.39 -0.26 -0.11 0.30 68.04 60.84 71.39 -1.17 -1.28 -0.20 3DShot2 37
38 3Dpro 68.04 58.00 69.57 -0.26 -0.75 -0.10 73.15 65.53 71.73 0.79 -0.00 -0.08 3Dpro 38
39 Fiser−M4T 67.90 65.15 65.21 -0.30 0.86 -1.06 67.90 65.15 65.21 -1.23 -0.11 -2.26 Fiser−M4T 39
40 LOOPP_Server 67.90 59.47 73.64 -0.30 -0.42 0.79 72.44 69.03 73.64 0.52 0.95 0.56 LOOPP_Server 40
41 circle 67.76 61.22 69.24 -0.33 -0.03 -0.17 68.61 63.16 69.56 -0.95 -0.65 -0.81 circle 41
42 FALCON 67.76 58.57 70.27 -0.33 -0.62 0.05 72.02 68.70 74.11 0.36 0.86 0.71 FALCON 42
43 HHpred2 67.61 60.42 71.79 -0.38 -0.21 0.38 67.61 60.42 71.79 -1.34 -1.39 -0.06 HHpred2 43
44 Pcons_local 67.61 57.29 70.19 -0.38 -0.91 0.03 73.01 69.32 71.99 0.74 1.03 0.00 Pcons_local 44
45 GS−MetaServer2 67.61 57.10 69.25 -0.38 -0.95 -0.17 68.89 63.97 74.04 -0.85 -0.43 0.69 GS−MetaServer2 45
46 FEIG 67.47 58.66 74.22 -0.41 -0.60 0.92 70.03 64.06 74.22 -0.41 -0.40 0.75 FEIG 46
47 YASARA 67.47 56.30 68.67 -0.41 -1.13 -0.30 67.47 56.30 68.67 -1.39 -2.52 -1.10 YASARA 47
48 CpHModels 67.33 63.73 67.38 -0.45 0.54 -0.58 67.33 63.73 67.38 -1.45 -0.49 -1.53 CpHModels 48
49 Phyre2 67.33 62.03 68.08 -0.45 0.16 -0.43 71.31 64.39 71.08 0.08 -0.31 -0.30 Phyre2 49
50 nFOLD3 67.19 57.15 70.21 -0.49 -0.94 0.04 73.15 69.56 73.33 0.79 1.09 0.45 nFOLD3 50
51 FUGUE_KM 66.90 59.33 68.98 -0.57 -0.45 -0.23 66.90 59.33 68.98 -1.61 -1.69 -1.00 FUGUE_KM 51
52 ACOMPMOD 66.90 59.33 69.07 -0.57 -0.45 -0.21 66.90 59.33 69.07 -1.61 -1.69 -0.97 ACOMPMOD 52
53 Phragment 66.90 58.29 67.28 -0.57 -0.68 -0.60 70.60 60.27 71.01 -0.19 -1.43 -0.32 Phragment 53
54 GeneSilicoMetaServer 66.90 57.34 69.23 -0.57 -0.90 -0.18 73.86 69.51 72.95 1.06 1.08 0.33 GeneSilicoMetaServer 54
55 Poing 66.76 59.23 67.86 -0.61 -0.47 -0.48 71.02 65.91 71.02 -0.03 0.10 -0.32 Poing 55
56 fais−server 66.48 59.38 71.47 -0.68 -0.44 0.31 71.31 66.29 71.47 0.08 0.20 -0.17 fais−server 56
57 COMA 66.33 62.07 63.66 -0.72 0.17 -1.40 72.02 69.27 71.91 0.36 1.01 -0.02 COMA 57
58 HHpred5 65.34 55.02 60.61 -0.99 -1.42 -2.06 65.34 55.02 60.61 -2.21 -2.86 -3.79 HHpred5 58
59 SAM−T02−server 64.63 55.11 67.63 -1.19 -1.40 -0.53 66.62 60.56 70.06 -1.72 -1.36 -0.64 SAM−T02−server 59
60 HHpred4 63.78 53.74 62.03 -1.42 -1.71 -1.75 63.78 53.74 62.03 -2.81 -3.21 -3.32 HHpred4 60
61 MUFOLD−Server 63.07 50.33 65.89 -1.61 -2.48 -0.91 73.44 68.70 71.24 0.90 0.86 -0.25 MUFOLD−Server 61
62 OLGAFS 61.93 57.58 56.20 -1.93 -0.84 -3.03 61.93 57.58 58.42 -3.52 -2.17 -4.53 OLGAFS 62
63 Pushchino 52.56 43.75 45.77 -4.48 -3.96 -5.31 52.56 43.75 45.77 -7.12 -5.93 -8.75 Pushchino 63
64 FALCON_CONSENSUS 50.14 41.05 52.17 -5.14 -4.57 -3.91 67.90 60.61 74.11 -1.23 -1.34 0.71 FALCON_CONSENSUS 64
65 mariner1 34.80 30.07 26.79 -9.33 -7.04 -9.47 66.33 59.99 70.87 -1.83 -1.51 -0.37 mariner1 65
66 FOLDpro 33.24 29.55 28.66 -9.75 -7.16 -9.06 72.30 68.04 70.99 0.46 0.68 -0.33 FOLDpro 66
67 MUFOLD−MD 17.90 15.34 37.93 -13.94 -10.36 -7.03 25.71 20.79 40.70 -17.43 -12.18 -10.44 MUFOLD−MD 67
68 RBO−Proteus 17.33 15.86 36.96 -14.09 -10.24 -7.24 21.02 17.14 38.61 -19.23 -13.17 -11.14 RBO−Proteus 68
69 RANDOM 14.81 12.80 14.81 -14.78 -10.93 -12.09 14.81 12.80 14.81 -21.62 -14.35 -19.08 RANDOM 69
70 schenk−torda−server 12.93 11.46 20.53 -15.29 -11.23 -10.84 12.93 11.46 20.53 -22.34 -14.72 -17.17 schenk−torda−server 70
71 mahmood−torda−server 12.64 11.03 17.55 -15.37 -11.33 -11.49 15.77 11.13 17.55 -21.25 -14.81 -18.17 mahmood−torda−server 71
72 BHAGEERATH                   -14.78 -10.93 -12.09                   -21.62 -14.35 -19.08 BHAGEERATH 72
73 huber−torda−server                   -14.78 -10.93 -12.09                   -21.62 -14.35 -19.08 huber−torda−server 73
74 test_http_server_01                   -14.78 -10.93 -12.09                   0.46 0.68 -19.08 test_http_server_01 74