T0459

X-ray Targets
387 388 389 390
391 392 393 394
395 396 397 398
399 400 401 402
403 404 405 406
407 408 409 410
411 412 413 414
415 416 417 418
419 420 421 422
423 424 425 426
427 428 429 430
431 432 433 434
435 436 438 439
440 441 442 443
444 445 446 447
448 449 450 451
452 453 454 455
456 457 458 459
461 463 465 470
477 478 479 481
483 485 486 487
488 489 490 491
493 494 495 496
497 501 502 503
504 505 506 507
508 509 510 511
512 513 514

T0459

HxlR family transcriptional factor from Thermoplasma volcanium

Target type: Server only

Target sequence:

>T0459 APC89000, Thermoplasma volcanium, 111 residues
SNAMLRYGDTEICIDPSESVLHLLGKKYTMLIISVLGNGSTRQNFNDIRSSIPGISSTILSRRIKDLIDSGLVERRSGQITTYALTEKGMNVRNSLMPLLQYISVLDRNGD

Structure:
Method: X-ray, res=1.65Å, R/Rfree=0.17/0.21
Determined by: MCSG
PDB ID: 3df8

3df8_A,A* cartoon
Ribbon diagram of 459: 3df8 chain A (rainbow) with its symmetry mate (white).

PyMOL of 3df8

Domains:  PyMOL of domains

Single domain protein. However, due to a domain swap of the N-terminal β-hairpin, the compact domain is different from the entire chain. Its residue range in PDB is B:-2-22,A:23-106.

459 domain evaluation plot
Correlation between GDT-TS scores for domain-based evlatuation with a swapped domain (y, vertical axis) and whole chain GDT-TS (x, horizontal axis).

459 domain evaluation plot
Correlation between GDT-TS scores for domain-based evlatuation with N-terminal segment removed (just A:23-106, y, vertical axis) and whole chain GDT-TS (x, horizontal axis).

Each point represents first server model. Green, gray and black points are top 10, bottom 25% and the rest of prediction models. Blue line is the best-fit slope line (intercept 0) to the top 10 server models. Red line is the diagonal. Slope and root mean square y-x distance for the top 10 models (average difference between the domain GDT-TS scores and the whole chain GDT-TS score) are shown above the plot.

Structure classification:

DNA/RNA-binding 3-helical bundle fold, winged HTH (green-yellow HTH helices).

3df8_A,A* cartoon
Cartoon diagram of 459: 3df8 chain A.

CASP category:

Whole chain: Comparative modeling:medium.

Domain (swap segment removed): Comparative modeling:easy. Domain (swap): Comparative modeling:medium.

Closest templates:

1z7u, 1yyv, 2fsw, 2hzt.

Target sequence - PDB file inconsistencies:

T0459    3df8.pdb    T0459.pdb    PyMOL    PyMOL of domains    

T0459    1 SNAMLRYGDTEICIDPSESVLHLLGKKYTMLIISVLGNGSTRQNFNDIRSSIPGISSTILSRRIKDLIDSGLVERRSGQITTYALTEKGMNVRNSLMPLLQYISVLDRNGD 111
           |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~
3df8A   -2 SNAMLRYGDTEICIDPSESVLHLLGKKYTMLIISVLGNGSTRQNFNDIRSSIPGISSTILSRRIKDLIDSGLVERRSGQITTYALTEKGMNVRNSLMPLLQYISVLDRN-- 106

Residue change log: change 1, 27, 87, 94, MSE to MET;

We suggest to evaluate this target as a single domain spanning whole chain. However, due to a domain swap of the N-terminal β-hairpin, the compact domain is different from the entire chain. Its residue range in PDB is B:-2-22, A:23-106. Since no server predicted the swap well, we removed the swapped N-terminal segment (pdb A:-2-A:22) for evaluation, resulting this domain definition:

1st domain: target 26-109 ; pdb 23-106

Sequence classification:

HxlR-like helix-turn-helix (DUF24) in Pfam.

Server predictions:

T0459:pdb -2-106:seq 1-109:CM_medium;   alignment

distribution of first scores
First models for T0459: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

459_1:pdb 23-106:seq 26-109:CM_easy;   alignment

distribution of first scores
First models for T0459_1: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

459_1s:pdb B:-2-22,A:23-106:seq 1-109:CM_medium;   alignment

distribution of first scores
First models for T0459_1s: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

# GROUP ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ ↓ GROUP #
T0459 459_1 459_1s T0459 459_1 459_1s T0459 459_1 459_1s T0459 459_1 459_1s
First score First Z-score Best score Best Z-score
1 YASARA 76.61 71.48 79.82 89.58 87.20 90.27 69.95 68.42 68.28 1.67 1.64 1.84 1.62 2.26 1.52 1.65 2.14 1.81 76.61 71.64 79.82 89.58 87.20 90.27 69.95 68.42 68.28 1.65 1.34 1.67 1.55 1.57 1.52 1.54 1.85 1.55 YASARA 1
2 Zhang−Server 76.38 73.32 78.53 90.18 79.46 89.49 70.41 67.66 67.14 1.63 1.94 1.61 1.73 0.96 1.41 1.77 1.99 1.55 76.38 74.01 78.53 90.77 83.23 89.49 70.87 67.66 67.14 1.59 1.83 1.40 1.86 0.89 1.35 1.84 1.68 1.24 Zhang−Server 2
3 RAPTOR 75.69 73.39 77.46 89.58 77.28 88.46 69.72 60.24 66.41 1.49 1.95 1.42 1.62 0.60 1.26 1.60 0.56 1.38 76.38 73.93 77.46 89.58 87.40 88.46 69.72 67.66 66.41 1.59 1.81 1.18 1.55 1.61 1.12 1.46 1.68 1.04 RAPTOR 3
4 GS−KudlatyPred 75.23 62.69 74.64 87.50 80.36 85.42 67.89 62.38 64.17 1.40 0.18 0.93 1.23 1.11 0.82 1.15 0.98 0.86 75.23 64.60 75.68 87.50 80.36 85.91 67.89 62.38 65.30 1.30 -0.11 0.80 1.02 0.40 0.56 0.87 0.45 0.74 GS−KudlatyPred 4
5 LEE−SERVER 75.00 68.73 76.10 87.20 80.85 86.83 67.66 62.77 65.65 1.36 1.18 1.19 1.18 1.20 1.02 1.10 1.05 1.20 75.00 71.18 76.10 87.20 84.42 86.83 67.66 65.06 65.65 1.24 1.24 0.89 0.95 1.09 0.76 0.79 1.07 0.83 LEE−SERVER 5
6 HHpred5 74.54 70.87 75.43 87.80 72.92 86.40 67.89 56.27 64.95 1.27 1.54 1.07 1.29 -0.13 0.96 1.15 -0.20 1.04 74.54 70.87 75.43 87.80 72.92 86.40 67.89 56.27 64.95 1.12 1.18 0.75 1.10 -0.88 0.67 0.87 -0.97 0.64 HHpred5 6
7 MULTICOM−RANK 73.85 70.80 72.03 86.31 82.54 82.59 66.74 63.84 61.93 1.14 1.53 0.47 1.01 1.48 0.41 0.87 1.26 0.34 73.85 70.80 72.03 86.31 82.54 82.59 66.74 63.84 61.93 0.95 1.17 0.03 0.72 0.77 -0.17 0.49 0.79 -0.18 MULTICOM−RANK 7
8 3DShot2 73.39 65.67 71.33 86.91 85.71 82.66 67.43 65.60 61.82 1.05 0.68 0.35 1.12 2.01 0.42 1.04 1.60 0.32 73.39 65.67 71.33 86.91 85.71 82.66 67.43 65.60 61.82 0.83 0.11 -0.12 0.87 1.32 -0.16 0.72 1.20 -0.21 3DShot2 8
9 Phyre_de_novo 72.94 68.81 77.35 84.82 74.11 87.50 66.28 63.84 66.11 0.96 1.20 1.40 0.74 0.07 1.12 0.76 1.26 1.31 73.85 70.34 77.48 87.50 85.12 89.61 68.58 63.84 66.59 0.95 1.07 1.18 1.02 1.21 1.38 1.09 0.79 1.09 Phyre_de_novo 9
10 FAMSD 72.94 67.43 70.76 85.71 70.44 82.38 66.28 54.51 61.66 0.96 0.97 0.25 0.90 -0.55 0.37 0.76 -0.54 0.28 72.94 67.43 72.10 85.71 76.39 83.50 66.28 59.33 62.48 0.71 0.47 0.05 0.56 -0.28 0.03 0.34 -0.26 -0.03 FAMSD 10
11 keasar−server 72.48 65.90 72.46 86.31 81.35 83.63 66.97 64.07 63.09 0.88 0.71 0.55 1.01 1.28 0.56 0.93 1.30 0.61 72.94 69.50 76.83 86.31 84.42 88.39 66.97 65.60 66.29 0.71 0.90 1.04 0.72 1.09 1.11 0.57 1.20 1.01 keasar−server 11
12 pro−sp3−TASSER 71.79 67.66 70.63 86.01 80.85 80.94 66.97 63.07 60.84 0.74 1.01 0.23 0.96 1.20 0.17 0.93 1.11 0.09 75.00 71.86 76.45 89.58 87.20 88.53 69.72 67.89 65.59 1.24 1.38 0.96 1.55 1.57 1.14 1.46 1.73 0.82 pro−sp3−TASSER 12
13 FFASsuboptimal 71.79 63.99 71.86 84.82 81.25 84.54 66.28 63.53 62.19 0.74 0.40 0.44 0.74 1.26 0.69 0.76 1.20 0.40 72.48 65.14 72.54 85.42 81.84 84.73 66.97 63.53 62.76 0.60 -0.00 0.14 0.49 0.65 0.30 0.57 0.72 0.05 FFASsuboptimal 13
14 MUFOLD−Server 71.79 62.16 70.45 85.12 74.41 81.15 66.28 58.03 61.04 0.74 0.10 0.20 0.79 0.12 0.20 0.76 0.14 0.14 71.79 64.30 72.63 85.12 78.08 84.44 66.28 60.40 63.07 0.42 -0.18 0.16 0.41 0.01 0.24 0.34 -0.01 0.13 MUFOLD−Server 14
15 MUProt 71.79 58.49 73.10 84.82 79.66 83.76 65.83 61.85 62.81 0.74 -0.51 0.66 0.74 1.00 0.58 0.65 0.87 0.55 74.77 68.65 73.87 88.69 79.66 84.41 68.81 61.85 63.39 1.18 0.72 0.42 1.33 0.28 0.23 1.17 0.33 0.22 MUProt 15
16 pipe_int 71.56 66.06 76.53 81.84 76.29 87.43 64.22 56.27 66.08 0.70 0.74 1.26 0.18 0.43 1.11 0.26 -0.20 1.30 71.56 66.06 76.53 81.84 76.29 87.43 65.83 57.11 66.08 0.36 0.19 0.98 -0.42 -0.30 0.90 0.20 -0.78 0.95 pipe_int 16
17 METATASSER 71.33 64.60 74.25 85.12 83.53 85.09 66.28 64.45 64.07 0.65 0.50 0.86 0.79 1.64 0.77 0.76 1.37 0.84 74.31 72.63 79.05 87.50 85.91 89.74 68.58 67.36 67.50 1.06 1.54 1.51 1.02 1.35 1.41 1.09 1.61 1.34 METATASSER 17
18 MULTICOM−REFINE 71.10 65.60 73.14 84.23 79.07 83.61 65.83 58.79 62.82 0.61 0.66 0.67 0.63 0.90 0.55 0.65 0.29 0.55 71.10 69.19 75.78 89.88 88.49 90.14 72.02 70.95 67.70 0.24 0.83 0.82 1.63 1.79 1.50 2.21 2.44 1.39 MULTICOM−REFINE 18
19 panther_server 71.10 63.61 72.76 84.23 77.68 83.45 65.83 60.78 62.74 0.61 0.34 0.60 0.63 0.66 0.53 0.65 0.67 0.53 71.10 67.28 72.76 84.23 80.95 85.20 65.83 62.84 62.74 0.24 0.44 0.18 0.19 0.50 0.40 0.20 0.56 0.04 panther_server 19
20 BioSerf 71.10 62.69 69.96 83.93 72.62 78.80 65.14 56.42 60.28 0.61 0.18 0.11 0.57 -0.18 -0.15 0.48 -0.17 -0.04 71.10 62.69 69.96 83.93 72.62 78.80 65.14 56.42 60.28 0.24 -0.51 -0.41 0.11 -0.93 -1.01 -0.03 -0.94 -0.63 BioSerf 20
21 Pcons_multi 70.64 64.83 73.24 84.23 78.87 83.06 66.06 61.77 63.41 0.52 0.54 0.69 0.63 0.86 0.47 0.71 0.86 0.69 71.79 66.90 74.50 85.71 80.36 85.84 66.51 62.38 64.57 0.42 0.36 0.55 0.56 0.40 0.55 0.42 0.45 0.54 Pcons_multi 21
22 fais−server 70.41 64.91 72.89 83.04 77.68 83.43 64.22 60.09 62.75 0.48 0.55 0.62 0.41 0.66 0.53 0.26 0.54 0.53 72.94 67.97 74.23 85.71 77.68 85.92 66.74 60.09 64.69 0.71 0.58 0.49 0.56 -0.06 0.56 0.49 -0.08 0.57 fais−server 22
23 PSI 70.18 59.63 73.32 82.44 80.66 83.88 64.45 54.97 63.09 0.43 -0.32 0.70 0.29 1.16 0.59 0.31 -0.45 0.61 72.02 68.20 73.32 84.52 80.66 83.88 65.83 59.40 63.09 0.48 0.63 0.30 0.26 0.45 0.11 0.20 -0.24 0.14 PSI 23
24 huber−torda−server 69.95 65.98 70.14 83.04 70.54 81.73 64.22 60.86 60.78 0.39 0.73 0.14 0.41 -0.53 0.28 0.26 0.68 0.08 69.95 65.98 70.14 83.04 71.53 81.73 64.22 60.86 60.78 -0.05 0.17 -0.37 -0.12 -1.12 -0.36 -0.33 0.10 -0.49 huber−torda−server 24
25 mGenTHREADER 69.95 65.06 67.05 82.44 66.77 77.85 64.68 52.60 58.22 0.39 0.58 -0.40 0.29 -1.16 -0.28 0.37 -0.91 -0.51 69.95 65.06 67.05 82.44 66.77 77.85 64.68 52.60 58.22 -0.05 -0.02 -1.02 -0.27 -1.93 -1.22 -0.18 -1.83 -1.19 mGenTHREADER 25
26 FFASstandard 69.95 62.92 73.49 83.93 78.17 85.56 65.60 61.16 63.26 0.39 0.22 0.73 0.57 0.75 0.84 0.60 0.74 0.65 72.48 66.36 73.49 85.42 81.84 85.56 66.97 61.62 63.26 0.60 0.25 0.34 0.49 0.65 0.48 0.57 0.27 0.18 FFASstandard 26
27 FFASflextemplate 69.95 62.92 73.49 83.93 78.17 85.56 65.60 61.16 63.26 0.39 0.22 0.73 0.57 0.75 0.84 0.60 0.74 0.65 70.18 67.28 73.49 83.93 80.16 85.56 65.60 62.46 63.26 0.01 0.44 0.34 0.11 0.36 0.48 0.12 0.47 0.18 FFASflextemplate 27
28 MULTICOM−CMFR 69.27 64.22 70.84 81.84 75.10 81.01 63.76 59.02 60.96 0.26 0.44 0.26 0.18 0.23 0.18 0.15 0.33 0.12 74.31 70.95 74.64 88.09 85.71 85.59 68.58 66.74 63.98 1.06 1.20 0.58 1.17 1.32 0.49 1.09 1.46 0.38 MULTICOM−CMFR 28
29 HHpred4 69.27 62.08 76.75 80.95 73.81 87.56 63.30 57.80 66.18 0.26 0.08 1.30 0.02 0.02 1.13 0.03 0.09 1.33 69.27 62.08 76.75 80.95 73.81 87.56 63.30 57.80 66.18 -0.22 -0.64 1.03 -0.65 -0.73 0.93 -0.62 -0.62 0.98 HHpred4 29
30 Fiser−M4T 69.04 66.28 67.35 80.36 66.27 79.92 62.62 51.76 58.65 0.21 0.78 -0.35 -0.09 -1.25 0.02 -0.13 -1.07 -0.41 69.04 66.28 67.35 80.36 66.27 79.92 62.62 51.76 58.65 -0.28 0.23 -0.95 -0.80 -2.02 -0.76 -0.85 -2.02 -1.07 Fiser−M4T 30
31 MULTICOM−CLUSTER 69.04 63.23 68.67 80.66 73.71 78.72 62.84 57.49 59.08 0.21 0.27 -0.12 -0.04 -0.00 -0.16 -0.08 0.04 -0.31 73.85 70.80 72.45 86.31 82.54 84.88 67.43 64.53 64.91 0.95 1.17 0.12 0.72 0.77 0.33 0.72 0.95 0.63 MULTICOM−CLUSTER 31
32 GeneSilicoMetaServer 69.04 57.42 68.71 81.25 70.93 78.14 63.30 55.35 59.27 0.21 -0.69 -0.11 0.07 -0.47 -0.24 0.03 -0.38 -0.27 69.04 65.37 71.50 81.25 76.79 83.13 63.30 58.18 61.62 -0.28 0.04 -0.08 -0.57 -0.21 -0.05 -0.62 -0.53 -0.26 GeneSilicoMetaServer 32
33 BAKER−ROBETTA 68.81 66.51 71.07 82.14 79.36 81.04 63.99 61.09 61.73 0.17 0.82 0.31 0.24 0.95 0.18 0.20 0.73 0.30 70.87 68.88 73.34 83.63 81.65 82.76 64.91 63.38 63.61 0.18 0.77 0.31 0.03 0.62 -0.13 -0.10 0.68 0.28 BAKER−ROBETTA 33
34 nFOLD3 68.58 65.67 66.17 82.44 67.16 78.88 63.99 59.86 57.90 0.13 0.68 -0.55 0.29 -1.10 -0.13 0.20 0.49 -0.59 68.58 65.67 69.88 82.44 69.64 82.97 63.99 59.86 60.59 -0.40 0.11 -0.42 -0.27 -1.44 -0.09 -0.40 -0.14 -0.54 nFOLD3 34
35 GS−MetaServer2 68.58 62.16 66.62 82.14 74.80 78.44 63.76 58.10 57.92 0.13 0.10 -0.47 0.24 0.18 -0.20 0.15 0.15 -0.58 68.58 62.16 72.73 82.14 74.80 83.09 63.76 58.10 62.71 -0.40 -0.62 0.18 -0.35 -0.56 -0.06 -0.47 -0.55 0.03 GS−MetaServer2 35
36 COMA 68.35 64.37 72.16 80.36 76.39 80.75 62.62 58.33 62.74 0.08 0.46 0.50 -0.09 0.45 0.14 -0.13 0.20 0.53 71.10 64.83 75.46 83.93 76.98 86.77 64.91 59.56 65.19 0.24 -0.07 0.75 0.11 -0.18 0.75 -0.10 -0.21 0.71 COMA 36
37 COMA−M 68.35 61.01 75.46 80.06 72.52 86.77 62.84 57.80 65.19 0.08 -0.09 1.07 -0.15 -0.20 1.01 -0.08 0.09 1.10 69.72 62.23 75.46 82.44 78.47 86.77 63.76 60.70 65.19 -0.11 -0.60 0.75 -0.27 0.07 0.75 -0.47 0.06 0.71 COMA−M 37
38 Pushchino 68.35 56.88 63.25 80.36 75.79 75.94 62.84 59.33 55.09 0.08 -0.78 -1.06 -0.09 0.35 -0.56 -0.08 0.39 -1.23 68.35 56.88 63.25 80.36 75.79 75.94 62.84 59.33 55.09 -0.46 -1.71 -1.82 -0.80 -0.39 -1.64 -0.77 -0.26 -2.04 Pushchino 38
39 SAM−T02−server 67.89 63.46 65.61 81.84 77.28 82.95 63.76 60.24 56.96 -0.01 0.31 -0.65 0.18 0.60 0.46 0.15 0.56 -0.80 70.41 66.90 71.14 83.63 81.84 84.21 65.37 61.85 61.60 0.07 0.36 -0.16 0.03 0.65 0.19 0.05 0.33 -0.27 SAM−T02−server 39
40 SAM−T08−server 67.66 59.25 74.42 80.95 73.02 84.81 63.30 57.19 64.16 -0.05 -0.39 0.89 0.02 -0.12 0.73 0.03 -0.02 0.86 69.27 62.23 74.42 81.84 75.20 84.91 63.30 58.18 64.16 -0.22 -0.60 0.53 -0.42 -0.49 0.34 -0.62 -0.53 0.43 SAM−T08−server 40
41 PS2−server 67.20 60.47 75.28 77.98 69.64 85.59 61.47 48.93 65.20 -0.14 -0.18 1.04 -0.53 -0.68 0.84 -0.41 -1.61 1.10 72.48 68.81 75.28 85.42 83.23 86.93 66.28 64.60 65.20 0.60 0.75 0.72 0.49 0.89 0.79 0.34 0.97 0.71 PS2−server 41
42 HHpred2 66.74 58.95 72.69 79.17 74.21 83.56 62.16 53.13 62.92 -0.23 -0.44 0.59 -0.31 0.08 0.55 -0.24 -0.80 0.57 66.74 58.95 72.69 79.17 74.21 83.56 62.16 53.13 62.92 -0.87 -1.28 0.17 -1.11 -0.66 0.04 -0.99 -1.70 0.09 HHpred2 42
43 MUSTER 66.51 63.53 65.00 78.57 72.62 72.84 61.24 57.11 56.80 -0.27 0.32 -0.76 -0.42 -0.18 -1.01 -0.47 -0.04 -0.84 72.25 68.27 71.35 85.42 82.64 82.18 66.51 64.37 62.13 0.54 0.64 -0.11 0.49 0.79 -0.26 0.42 0.91 -0.12 MUSTER 43
44 FEIG 66.28 63.69 72.15 83.93 81.15 85.33 67.89 62.84 64.77 -0.32 0.35 0.49 0.57 1.25 0.80 1.15 1.06 1.00 69.04 63.84 72.57 84.52 81.15 86.96 67.89 63.07 65.33 -0.28 -0.27 0.14 0.26 0.53 0.79 0.87 0.61 0.75 FEIG 44
45 Phragment 65.37 61.85 62.08 76.19 73.41 63.33 59.17 56.27 54.94 -0.49 0.04 -1.27 -0.86 -0.05 -2.40 -0.97 -0.20 -1.27 74.08 70.57 79.22 87.80 85.81 88.87 68.81 62.00 68.48 1.00 1.12 1.55 1.10 1.33 1.22 1.17 0.36 1.60 Phragment 45
46 Poing 65.37 61.39 61.70 76.19 73.41 63.33 59.17 56.27 54.63 -0.49 -0.03 -1.34 -0.86 -0.05 -2.40 -0.97 -0.20 -1.34 74.08 70.57 79.49 87.80 85.81 88.87 68.81 60.78 68.71 1.00 1.12 1.60 1.10 1.33 1.22 1.17 0.08 1.67 Poing 46
47 Pcons_local 65.37 57.57 65.57 77.98 68.85 77.82 61.01 53.06 57.31 -0.49 -0.66 -0.66 -0.53 -0.82 -0.29 -0.52 -0.82 -0.72 69.04 62.62 66.77 83.04 74.90 79.80 64.68 58.41 58.69 -0.28 -0.52 -1.08 -0.12 -0.54 -0.79 -0.18 -0.47 -1.06 Pcons_local 47
48 Pcons_dot_net 65.37 57.57 65.57 77.98 68.85 77.82 61.01 53.06 57.31 -0.49 -0.66 -0.66 -0.53 -0.82 -0.29 -0.52 -0.82 -0.72 70.64 68.04 73.34 83.93 81.65 82.24 65.14 63.38 63.61 0.13 0.60 0.31 0.11 0.62 -0.25 -0.03 0.68 0.28 Pcons_dot_net 48
49 Phyre2 65.14 62.08 62.61 76.19 73.41 63.33 59.17 56.27 55.38 -0.54 0.08 -1.18 -0.86 -0.05 -2.40 -0.97 -0.20 -1.17 74.08 70.57 79.00 87.80 85.81 88.89 68.81 61.31 68.29 1.00 1.12 1.50 1.10 1.33 1.22 1.17 0.20 1.55 Phyre2 49
50 ACOMPMOD 65.14 54.28 61.64 75.30 63.00 71.98 58.72 49.23 53.85 -0.54 -1.21 -1.35 -1.03 -1.80 -1.14 -1.08 -1.55 -1.52 65.14 54.28 64.43 75.30 64.58 79.20 58.72 50.23 56.65 -1.28 -2.25 -1.57 -2.09 -2.31 -0.92 -2.11 -2.38 -1.62 ACOMPMOD 50
51 forecast 63.99 59.40 63.69 81.25 75.30 74.77 63.76 59.17 57.50 -0.76 -0.36 -0.99 0.07 0.27 -0.73 0.15 0.36 -0.68 63.99 59.40 63.69 81.25 75.30 74.92 64.22 59.17 57.50 -1.57 -1.19 -1.73 -0.57 -0.47 -1.87 -0.33 -0.30 -1.38 forecast 51
52 Frankenstein 63.99 55.12 71.11 80.95 72.22 85.34 64.91 55.89 63.98 -0.76 -1.07 0.31 0.02 -0.25 0.81 0.43 -0.27 0.82 64.91 60.78 71.11 82.14 77.78 85.56 66.28 62.92 63.98 -1.34 -0.90 -0.16 -0.35 -0.04 0.48 0.34 0.58 0.38 Frankenstein 52
53 CpHModels 63.76 59.79 58.15 76.19 72.22 68.74 59.40 56.35 51.00 -0.80 -0.30 -1.96 -0.86 -0.25 -1.61 -0.92 -0.18 -2.18 63.76 59.79 58.15 76.19 72.22 68.74 59.40 56.35 51.00 -1.63 -1.11 -2.89 -1.87 -1.00 -3.23 -1.89 -0.95 -3.15 CpHModels 53
54 rehtnap 63.76 58.87 59.75 75.59 71.23 71.61 58.72 55.35 52.60 -0.80 -0.45 -1.68 -0.97 -0.42 -1.19 -1.08 -0.38 -1.81 63.76 58.87 59.75 75.59 71.23 71.61 58.72 55.35 52.60 -1.63 -1.30 -2.56 -2.02 -1.17 -2.60 -2.11 -1.19 -2.72 rehtnap 54
55 circle 63.76 57.34 72.26 80.66 71.13 84.89 65.37 61.54 65.79 -0.80 -0.70 0.51 -0.04 -0.43 0.74 0.54 0.81 1.24 68.81 65.60 72.26 81.25 76.19 84.89 65.37 61.54 65.79 -0.34 0.09 0.08 -0.57 -0.32 0.34 0.05 0.25 0.87 circle 55
56 3D−JIGSAW_V3 63.30 57.34 67.89 77.38 70.44 77.74 60.09 54.74 58.99 -0.89 -0.70 -0.25 -0.64 -0.55 -0.30 -0.75 -0.49 -0.33 63.30 59.63 67.89 77.38 73.02 77.74 60.09 56.73 58.99 -1.75 -1.14 -0.84 -1.56 -0.86 -1.24 -1.67 -0.86 -0.98 3D−JIGSAW_V3 56
57 3D−JIGSAW_AEP 63.07 57.11 67.95 75.30 69.94 76.81 58.72 54.59 59.04 -0.93 -0.74 -0.24 -1.03 -0.63 -0.44 -1.08 -0.52 -0.32 63.53 59.40 67.95 76.79 69.94 76.96 59.63 54.59 59.04 -1.69 -1.19 -0.83 -1.71 -1.39 -1.42 -1.82 -1.36 -0.97 3D−JIGSAW_AEP 57
58 FUGUE_KM 62.84 58.87 52.01 71.73 67.36 61.54 56.19 49.31 46.55 -0.98 -0.45 -3.03 -1.69 -1.07 -2.66 -1.70 -1.54 -3.20 64.68 60.40 67.64 82.74 77.98 82.14 66.28 62.62 62.15 -1.40 -0.98 -0.89 -0.19 -0.01 -0.27 0.34 0.51 -0.12 FUGUE_KM 58
59 3Dpro 61.93 56.12 63.65 77.38 71.63 75.34 60.78 55.43 57.69 -1.15 -0.90 -0.99 -0.64 -0.35 -0.65 -0.58 -0.36 -0.63 61.93 56.12 63.75 77.38 71.63 76.22 60.78 55.43 57.69 -2.10 -1.87 -1.71 -1.56 -1.10 -1.58 -1.44 -1.17 -1.33 3Dpro 59
60 Distill 61.93 53.82 65.13 74.11 64.58 75.55 57.80 46.18 56.43 -1.15 -1.29 -0.73 -1.25 -1.53 -0.62 -1.30 -2.14 -0.92 64.45 57.42 66.95 76.19 69.25 76.65 59.17 54.59 58.03 -1.45 -1.60 -1.04 -1.87 -1.51 -1.49 -1.97 -1.36 -1.24 Distill 60
61 SAM−T06−server 60.78 55.27 73.52 73.51 64.39 83.51 57.57 50.38 63.83 -1.37 -1.05 0.73 -1.36 -1.56 0.54 -1.36 -1.33 0.78 68.12 63.53 73.52 80.95 79.56 83.51 63.07 61.24 63.83 -0.52 -0.34 0.35 -0.65 0.26 0.03 -0.70 0.18 0.34 SAM−T06−server 61
62 FOLDpro 58.95 49.16 63.75 73.81 63.49 76.22 58.26 47.86 57.50 -1.73 -2.06 -0.98 -1.30 -1.71 -0.52 -1.19 -1.82 -0.68 61.93 56.12 63.75 77.38 71.63 76.22 60.78 55.43 57.69 -2.10 -1.87 -1.71 -1.56 -1.10 -1.58 -1.44 -1.17 -1.33 FOLDpro 62
63 FALCON_CONSENSUS 55.96 43.58 61.38 70.54 60.02 69.09 54.82 46.41 54.99 -2.30 -2.98 -1.39 -1.91 -2.30 -1.56 -2.03 -2.10 -1.26 55.96 43.58 62.25 70.54 60.02 71.68 54.82 46.41 55.77 -3.62 -4.46 -2.03 -3.31 -3.09 -2.58 -3.38 -3.26 -1.86 FALCON_CONSENSUS 63
64 MUFOLD−MD 43.81 37.23 47.74 55.36 54.37 55.78 44.27 40.60 45.69 -4.64 -4.03 -3.78 -4.72 -3.24 -3.50 -4.60 -3.21 -3.40 43.81 37.23 47.74 55.36 54.37 55.78 44.27 40.60 46.48 -6.72 -5.77 -5.09 -7.19 -4.06 -6.10 -6.81 -4.62 -4.38 MUFOLD−MD 64
65 LOOPP_Server 39.45 31.27 17.52 51.19 40.58 33.45 39.45 31.27 20.48 -5.47 -5.02 -9.07 -5.50 -5.55 -6.75 -5.77 -5.01 -9.22 51.15 47.55 40.87 64.29 61.71 56.55 49.54 47.55 38.27 -4.85 -3.64 -6.53 -4.91 -2.80 -5.93 -5.10 -3.00 -6.62 LOOPP_Server 65
66 RBO−Proteus 27.06 23.39 49.19 33.33 28.47 54.01 25.69 21.94 46.83 -7.86 -6.32 -3.53 -8.81 -7.58 -3.76 -9.13 -6.80 -3.14 28.90 26.76 50.75 35.12 32.64 55.29 27.06 25.15 47.55 -10.53 -7.93 -4.45 -12.36 -7.79 -6.21 -12.40 -8.21 -4.09 RBO−Proteus 66
67 mariner1 20.64 17.58 20.19 26.49 22.52 28.50 20.87 18.27 20.13 -9.09 -7.28 -8.60 -10.07 -8.58 -7.47 -10.30 -7.51 -9.30 60.78 55.43 61.35 74.41 65.87 78.73 57.80 50.77 53.39 -2.39 -2.01 -2.22 -2.32 -2.09 -1.03 -2.41 -2.25 -2.50 mariner1 67
68 OLGAFS 19.50 18.27 23.31 24.11 21.53 28.37 18.58 17.51 23.97 -9.31 -7.17 -8.06 -10.52 -8.75 -7.49 -10.86 -7.66 -8.42 68.35 59.02 62.95 81.84 72.52 75.83 63.76 56.58 54.84 -0.46 -1.27 -1.88 -0.42 -0.95 -1.67 -0.47 -0.90 -2.11 OLGAFS 68
69 RANDOM 19.09 16.40 19.09 25.16 22.07 25.16 20.83 17.62 20.83 -9.39 -7.48 -8.80 -10.32 -8.66 -7.96 -10.31 -7.63 -9.14 19.09 16.40 19.09 25.16 22.07 25.16 20.83 17.62 20.83 -13.03 -10.07 -11.12 -14.90 -9.61 -12.87 -14.43 -9.96 -11.37 RANDOM 69
70 schenk−torda−server 18.58 16.28 29.94 22.62 19.44 34.09 17.66 16.36 29.98 -9.49 -7.50 -6.90 -10.79 -9.10 -6.66 -11.08 -7.88 -7.03 21.56 17.43 29.94 27.98 22.92 34.09 22.48 18.12 29.98 -12.40 -9.86 -8.84 -14.18 -9.46 -10.89 -13.89 -9.84 -8.88 schenk−torda−server 70
71 mahmood−torda−server 17.66 14.60 23.65 22.62 19.34 23.43 17.43 14.91 24.43 -9.66 -7.78 -8.00 -10.79 -9.12 -8.21 -11.14 -8.16 -8.31 19.50 16.44 27.96 25.89 20.73 28.49 21.10 19.11 28.04 -12.93 -10.06 -9.25 -14.71 -9.84 -12.13 -14.34 -9.61 -9.40 mahmood−torda−server 71
72 FALCON 0.00 0.00 53.61 0.00 0.00 61.50 0.00 0.00 51.75 -13.06 -10.20 -2.75 -14.98 -12.36 -2.67 -15.38 -11.02 -2.00 56.65 53.13 62.25 70.54 66.57 71.68 55.51 51.38 55.77 -3.45 -2.48 -2.03 -3.31 -1.97 -2.58 -3.16 -2.11 -1.86 FALCON 72
73 BHAGEERATH                                                       -9.39 -7.48 -8.80 -10.32 -8.66 -7.96 -10.31 -7.63 -9.14                                                       -13.03 -10.07 -11.12 -14.90 -9.61 -12.87 -14.43 -9.96 -11.37 BHAGEERATH 73
74 test_http_server_01                                                       -9.39 -7.48 -8.80 -10.32 -8.66 -7.96 -10.31 -7.63 -9.14                                                       -13.03 -10.07 -11.12 -14.90 -9.61 -12.87 -14.43 -9.96 -11.37 test_http_server_01 74