T0506

X-ray Targets
387 388 389 390
391 392 393 394
395 396 397 398
399 400 401 402
403 404 405 406
407 408 409 410
411 412 413 414
415 416 417 418
419 420 421 422
423 424 425 426
427 428 429 430
431 432 433 434
435 436 438 439
440 441 442 443
444 445 446 447
448 449 450 451
452 453 454 455
456 457 458 459
461 463 465 470
477 478 479 481
483 485 486 487
488 489 490 491
493 494 495 496
497 501 502 503
504 505 506 507
508 509 510 511
512 513 514

T0506

protein Atu2129 from Agrobacterium tumefaciens

Target type: Server only

Target sequence:

>T0506 Atu2129, Agrobacterium tumefaciens, 254 residues
MLDVAPPVITPRGTKIEPSAGAPFEAVRVARDVLHTSRTAALATLDPVSGYPYTTATNIGIEPDGTPFFFAAGLTLHARNMETDARISVTLAPFGKGDALTLPRLTLVGRADRIGPDEVPLAIARYIARYPKAKLYLSLPDTRLYRLRTEGVQINGGPARNASNITPADLRTDLSGAEELMAAAESEATRLNAIKGEASRLAVLAGAKTGRWKITSIDPDGIDLASASDLARLWFAERVETLKQFEKALAQLLK

Structure:
Method: X-ray, res=1.94Å, R/Rfree=0.19/0.24
Determined by: MCSG
PDB ID: 3dnh

3dnh_A cartoon
Cartoon diagram of 506: 3dnh chain A

PyMOL of 3dnh

Domains:  PyMOL of domains

Two domains. Residue ranges in PDB: 4-173 and 174-254. Residue ranges in target: 4-173 and 174-254. Domain boundary well-defined.

3dnh_A cartoon
Cartoon diagram of 506 domains: 3dnh chain A
N- and C-domains are colored blue and red.

506 domain evaluation plot
Correlation between weighted by the number of residues sum of GDT-TS scores for domain-based evaluation (y, vertical axis) and whole chain GDT-TS (x, horizontal axis).

To compute the weighted sum, GDT-TS for each domain was multiplied by the domain length, and this sum was divided by the sum of domain lengths. Each point represents first server model. Green, gray and black points are top 10, bottom 25% and the rest of prediction models. Blue line is the best-fit slope line (intersection 0) to the top 10 server models. Red line is the diagonal. Slope and root mean square y-x distance for the top 10 models (average difference between the weighted sum of domain GDT-TS scores and the whole chain GDT-TS score) are shown above the plot.

Structure classification:

Split β-barrel fold with a unique C-terminal domain.

CASP category:

Whole chain: Comparative modeling:hard.

1st domain: Comparative modeling:medium. 2nd domain: Comparative modeling:medium.

Closest templates:

2arz.

Target sequence - PDB file inconsistencies:

T0506    3dnh.pdb    T0506.pdb    PyMOL    PyMOL of domains    

T0506    1 MLDVAPPVITPRGTKIEPSAGAPFEAVRVARDVLHTSRTAALATLDPVSGYPYTTATNIGIEPDGTPFFFAAGLTLHARNMETDARISVTLAPFGKGDALTLPRLTLVGRADRIGPDEVPLAIARYIARYPKAKLYLSLPDTRLYRLRTEGVQINGGPARNASNITPADLRTDLSGAEELMAAAESEATRLNAIKGEASRLAVLAGAKTGRWKITSIDPDGIDLASASDLARLWFAERVETLKQFEKALAQLLK 254
           ~~~|||||||||~~~~~~~~~~~|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3dnhA    4 ---VAPPVITPR-----------FEAVRVARDVLHTSRTAALATLDPVSGYPYTTATNIGIEPDGTPFFFAAGLTLHARNMETDARISVTLAPFGKGDALTLPRLTLVGRADRIGPDEVPLAIARYIARYPKAKLYLSLPDTRLYRLRTEGVQING------SNITPADLRTDLSGAEELMAAAESEATRLNAIKGEASRLAVLAGAKTGRWKITSIDPDGIDLASASDLARLWFAERVETLKQFEKALAQLLK 254

Residue change log: change 81, 181, MSE to MET;

We suggest to evaluate this target as a single domain spanning whole chain. However, evolutionarily this is a 2-domain protein:

1st domain: target 4-12, 24-156, 163-173 ; pdb 4-12, 24-156, 163-173

2nd domain: target 174-254 ; pdb 174-254

Sequence classification:

Matched Pyridoxamine 5'-phosphate oxidase family (Pyridox_oxidase) in Pfam.

Server predictions:

T0506:pdb 4-254:seq 4-254:CM_hard;   alignment

distribution of first scores
First models for T0506: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

506_1:pdb 4-173:seq 4-173:CM_medium;   alignment

distribution of first scores
First models for T0506_1: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

506_2:pdb 174-254:seq 174-254:CM_medium;   alignment

distribution of first scores
First models for T0506_2: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

# GROUP ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ ↓ GROUP #
T0506 506_1 506_2 T0506 506_1 506_2 T0506 506_1 506_2 T0506 506_1 506_2
First score First Z-score Best score Best Z-score
1 Phyre_de_novo 66.56 58.51 76.35 79.08 75.05 84.42 76.85 68.42 69.68 0.78 1.28 0.64 1.21 1.49 1.10 0.46 0.27 0.43 66.56 58.51 76.35 79.74 75.05 84.42 76.85 72.74 69.68 0.76 1.32 0.68 1.48 1.34 1.09 0.42 0.51 0.41 Phyre_de_novo 1
2 GS−KudlatyPred 66.35 57.23 75.80 77.94 71.95 83.67 75.93 69.75 70.37 0.74 0.96 0.58 0.82 0.69 0.91 0.37 0.39 0.53 66.35 57.23 75.80 77.94 72.44 83.67 77.47 69.75 70.49 0.72 0.93 0.60 0.73 0.58 0.86 0.50 0.19 0.56 GS−KudlatyPred 2
3 LEE−SERVER 66.03 56.91 76.25 79.74 75.60 85.94 74.38 69.86 66.88 0.67 0.88 0.63 1.44 1.63 1.48 0.22 0.40 0.06 66.99 58.41 76.25 81.05 78.11 85.94 75.62 69.86 67.53 0.86 1.29 0.67 2.03 2.22 1.55 0.26 0.20 0.01 LEE−SERVER 3
4 BioSerf 65.92 55.88 75.31 78.43 74.73 82.87 77.47 67.80 71.41 0.65 0.63 0.52 0.99 1.40 0.71 0.52 0.22 0.67 65.92 55.88 75.31 78.43 74.73 82.87 77.47 67.80 71.41 0.62 0.52 0.52 0.93 1.25 0.62 0.50 -0.01 0.74 BioSerf 4
5 keasar−server 65.70 56.66 74.16 77.78 72.55 82.55 76.23 73.56 68.20 0.61 0.82 0.38 0.76 0.84 0.63 0.40 0.72 0.24 66.13 56.73 74.36 79.08 72.55 82.58 77.16 73.87 70.68 0.67 0.78 0.37 1.21 0.62 0.54 0.46 0.62 0.60 keasar−server 5
6 Zhang−Server 65.60 56.41 76.17 78.59 72.17 83.33 75.93 67.90 71.57 0.59 0.76 0.62 1.04 0.74 0.83 0.37 0.22 0.69 66.03 56.41 76.17 79.25 74.78 83.58 75.93 69.65 71.57 0.64 0.68 0.66 1.28 1.26 0.84 0.30 0.18 0.77 Zhang−Server 6
7 RAPTOR 65.39 55.84 75.12 77.61 74.56 82.97 77.16 72.22 69.88 0.55 0.62 0.50 0.70 1.36 0.74 0.49 0.61 0.46 65.39 55.84 75.56 77.78 74.56 83.77 77.16 72.53 70.11 0.50 0.51 0.56 0.66 1.20 0.89 0.46 0.48 0.49 RAPTOR 7
8 GeneSilicoMetaServer 65.28 56.02 73.53 76.96 73.26 80.41 74.69 63.17 70.30 0.53 0.66 0.31 0.48 1.02 0.10 0.25 -0.19 0.52 65.28 56.02 73.53 77.45 73.26 81.16 75.00 69.24 70.30 0.47 0.56 0.23 0.53 0.82 0.11 0.18 0.14 0.53 GeneSilicoMetaServer 8
9 Poing 65.28 55.73 74.14 77.61 73.26 82.13 75.31 72.84 69.13 0.53 0.59 0.38 0.70 1.02 0.53 0.31 0.66 0.36 65.28 55.73 74.14 77.61 73.26 82.13 75.31 72.84 69.13 0.47 0.47 0.33 0.59 0.82 0.40 0.22 0.52 0.31 Poing 9
10 Phyre2 65.28 55.73 74.14 77.61 73.26 82.13 75.31 72.84 69.13 0.53 0.59 0.38 0.70 1.02 0.53 0.31 0.66 0.36 65.28 55.73 74.14 77.61 73.26 82.13 75.31 72.84 69.13 0.47 0.47 0.33 0.59 0.82 0.40 0.22 0.52 0.31 Phyre2 10
11 Phragment 65.28 55.66 74.17 77.61 73.15 82.18 75.31 72.84 69.13 0.53 0.57 0.38 0.70 1.00 0.54 0.31 0.66 0.36 65.28 55.66 74.17 77.61 73.15 82.18 75.31 72.84 69.13 0.47 0.45 0.34 0.59 0.79 0.42 0.22 0.52 0.31 Phragment 11
12 COMA−M 65.28 55.59 75.04 78.11 73.86 82.56 77.16 74.07 69.97 0.53 0.56 0.49 0.88 1.18 0.63 0.49 0.77 0.47 65.39 55.59 75.11 78.27 73.86 83.12 77.78 74.07 69.97 0.50 0.43 0.49 0.87 0.99 0.70 0.54 0.65 0.47 COMA−M 12
13 GS−MetaServer2 65.17 55.91 73.18 77.45 70.59 81.16 74.38 69.03 67.76 0.51 0.64 0.26 0.65 0.34 0.28 0.22 0.32 0.18 65.17 55.91 73.18 77.45 70.59 81.16 74.38 69.03 67.76 0.45 0.53 0.18 0.53 0.05 0.11 0.10 0.12 0.06 GS−MetaServer2 13
14 FAMSD 65.17 55.84 74.93 77.29 69.88 82.36 75.62 63.07 69.99 0.51 0.62 0.47 0.59 0.15 0.58 0.34 -0.20 0.48 65.17 55.84 74.93 77.29 70.64 82.36 75.93 72.74 70.48 0.45 0.51 0.46 0.46 0.06 0.47 0.30 0.51 0.56 FAMSD 14
15 fais−server 65.06 56.23 74.66 77.12 71.13 82.22 78.39 71.81 69.95 0.49 0.71 0.44 0.54 0.48 0.55 0.61 0.57 0.47 65.06 56.23 74.66 77.12 71.13 82.22 78.39 71.81 69.95 0.42 0.63 0.41 0.39 0.21 0.43 0.62 0.41 0.46 fais−server 15
16 3DShot2 64.85 55.66 73.92 77.29 72.39 80.61 76.85 73.97 70.32 0.45 0.57 0.35 0.59 0.80 0.15 0.46 0.76 0.52 64.85 55.66 73.92 77.29 72.39 80.61 76.85 73.97 70.32 0.38 0.45 0.30 0.46 0.57 -0.06 0.42 0.64 0.53 3DShot2 16
17 BAKER−ROBETTA 64.85 55.45 73.93 75.98 72.82 81.20 75.31 58.64 70.23 0.45 0.52 0.35 0.14 0.91 0.29 0.31 -0.59 0.51 66.35 57.23 75.80 78.76 73.97 83.67 77.47 69.75 70.49 0.72 0.93 0.60 1.07 1.03 0.86 0.50 0.19 0.56 BAKER−ROBETTA 17
18 Pcons_local 64.74 54.63 73.83 77.45 74.18 81.51 76.85 66.77 68.23 0.43 0.32 0.34 0.65 1.26 0.37 0.46 0.12 0.24 64.74 54.63 73.83 77.45 74.18 81.51 76.85 71.91 68.23 0.35 0.14 0.28 0.53 1.09 0.21 0.42 0.42 0.14 Pcons_local 18
19 Pcons_dot_net 64.74 54.63 73.83 77.45 74.18 81.51 76.85 66.77 68.23 0.43 0.32 0.34 0.65 1.26 0.37 0.46 0.12 0.24 65.39 56.34 73.83 77.45 74.18 81.64 76.85 71.81 68.73 0.50 0.66 0.28 0.53 1.09 0.25 0.42 0.41 0.24 Pcons_dot_net 19
20 SAM−T08−server 64.64 55.45 75.07 79.08 74.51 84.03 71.30 63.07 68.47 0.41 0.52 0.49 1.21 1.35 1.00 -0.07 -0.20 0.27 64.64 55.77 75.07 79.08 74.51 84.03 75.62 66.15 68.47 0.33 0.49 0.48 1.21 1.18 0.97 0.26 -0.19 0.19 SAM−T08−server 20
21 pipe_int 64.53 55.41 73.79 76.96 69.55 82.13 76.23 67.18 67.33 0.39 0.51 0.34 0.48 0.07 0.53 0.40 0.16 0.12 65.17 55.63 74.17 77.29 70.64 82.21 76.23 72.43 68.20 0.45 0.44 0.34 0.46 0.06 0.42 0.34 0.47 0.14 pipe_int 21
22 pro−sp3−TASSER 64.53 55.34 73.55 77.29 70.53 82.02 76.23 68.21 66.89 0.39 0.49 0.31 0.59 0.32 0.50 0.40 0.25 0.06 65.17 56.45 73.68 77.78 72.50 82.02 77.16 72.63 70.10 0.45 0.69 0.26 0.66 0.60 0.37 0.46 0.49 0.49 pro−sp3−TASSER 22
23 COMA 64.53 54.84 73.94 76.96 69.72 81.28 76.23 73.97 69.28 0.39 0.37 0.35 0.48 0.11 0.31 0.40 0.76 0.38 64.53 54.84 75.11 76.96 69.72 83.12 76.23 73.97 69.97 0.30 0.20 0.49 0.32 -0.20 0.70 0.34 0.64 0.47 COMA 23
24 MULTICOM−RANK 64.53 54.56 75.70 77.78 70.70 83.64 78.09 68.42 69.81 0.39 0.30 0.57 0.76 0.37 0.90 0.58 0.27 0.45 64.53 54.88 75.70 77.78 73.42 83.85 78.09 72.33 69.81 0.30 0.22 0.58 0.66 0.87 0.92 0.58 0.46 0.44 MULTICOM−RANK 24
25 MULTICOM−REFINE 64.42 54.24 75.81 77.12 70.26 84.33 75.62 71.50 69.01 0.37 0.22 0.58 0.54 0.25 1.08 0.34 0.54 0.34 64.42 54.63 76.22 77.12 72.98 84.33 79.32 76.65 70.93 0.28 0.14 0.66 0.39 0.74 1.06 0.74 0.92 0.65 MULTICOM−REFINE 25
26 MUProt 64.32 55.09 76.13 77.12 68.41 84.44 77.78 73.05 69.48 0.35 0.43 0.62 0.54 -0.22 1.10 0.55 0.68 0.41 64.42 55.59 76.13 77.29 70.10 84.44 78.70 76.85 70.77 0.28 0.43 0.65 0.46 -0.09 1.10 0.66 0.94 0.62 MUProt 26
27 MULTICOM−CMFR 64.32 55.06 75.52 77.61 70.10 83.41 77.78 71.61 69.71 0.35 0.42 0.54 0.70 0.21 0.85 0.55 0.55 0.44 64.85 55.06 75.90 77.61 71.13 84.26 79.01 76.34 69.71 0.38 0.27 0.61 0.59 0.21 1.04 0.70 0.88 0.42 MULTICOM−CMFR 27
28 MULTICOM−CLUSTER 64.32 54.56 75.71 77.12 68.19 83.58 78.39 76.13 70.01 0.35 0.30 0.57 0.54 -0.28 0.89 0.61 0.95 0.48 64.53 55.13 76.15 77.12 71.35 84.06 78.70 76.13 70.25 0.30 0.29 0.65 0.39 0.27 0.98 0.66 0.86 0.52 MULTICOM−CLUSTER 28
29 PSI 64.32 54.27 74.79 76.96 73.47 83.23 74.38 70.68 68.06 0.35 0.23 0.46 0.48 1.08 0.80 0.22 0.47 0.22 64.32 54.27 74.79 76.96 73.47 83.23 74.38 70.68 68.06 0.26 0.03 0.44 0.32 0.88 0.73 0.10 0.29 0.11 PSI 29
30 FFASsuboptimal 64.21 54.24 73.63 75.49 69.39 79.81 76.85 68.83 71.33 0.33 0.22 0.32 -0.03 0.03 -0.05 0.46 0.31 0.66 64.21 55.13 73.63 75.65 70.81 79.81 77.16 70.37 71.33 0.23 0.29 0.25 -0.22 0.11 -0.30 0.46 0.26 0.72 FFASsuboptimal 30
31 CpHModels 64.10 55.70 73.49 76.80 70.48 81.81 75.62 65.74 66.36 0.31 0.58 0.30 0.42 0.31 0.45 0.34 0.03 -0.01 64.10 55.70 73.49 76.80 70.48 81.81 75.62 65.74 66.36 0.21 0.47 0.23 0.25 0.02 0.30 0.26 -0.23 -0.20 CpHModels 31
32 FFASflextemplate 64.10 55.13 72.55 75.49 70.59 78.68 77.16 69.55 70.67 0.31 0.44 0.19 -0.03 0.34 -0.33 0.49 0.37 0.57 64.10 55.13 72.82 75.49 70.59 79.24 77.16 73.97 70.67 0.21 0.29 0.12 -0.29 0.05 -0.47 0.46 0.64 0.60 FFASflextemplate 32
33 ACOMPMOD 64.10 53.85 72.86 76.96 71.41 81.50 74.69 70.99 65.84 0.31 0.12 0.22 0.48 0.55 0.37 0.25 0.50 -0.08 64.10 53.85 72.86 76.96 71.41 81.50 74.69 70.99 65.84 0.21 -0.10 0.13 0.32 0.29 0.21 0.14 0.32 -0.30 ACOMPMOD 33
34 huber−torda−server 64.00 55.31 70.26 76.14 70.04 77.18 76.54 73.46 66.93 0.29 0.49 -0.09 0.20 0.20 -0.71 0.43 0.72 0.07 64.00 55.31 70.26 76.14 70.04 77.18 76.54 73.46 66.93 0.18 0.35 -0.29 -0.02 -0.11 -1.09 0.38 0.58 -0.10 huber−torda−server 34
35 3D−JIGSAW_AEP 64.00 55.23 71.55 75.16 69.61 77.73 75.62 65.33 69.00 0.29 0.47 0.07 -0.14 0.08 -0.57 0.34 -0.00 0.34 65.39 57.34 72.05 75.16 69.61 78.57 75.62 65.53 69.05 0.50 0.97 -0.00 -0.43 -0.23 -0.67 0.26 -0.25 0.30 3D−JIGSAW_AEP 35
36 SAM−T02−server 63.89 54.13 70.65 75.49 69.39 78.47 73.77 64.51 66.27 0.27 0.19 -0.04 -0.03 0.03 -0.39 0.17 -0.08 -0.02 63.89 54.13 70.65 75.49 69.39 78.47 73.77 64.51 66.27 0.16 -0.01 -0.22 -0.29 -0.30 -0.70 0.02 -0.36 -0.22 SAM−T02−server 36
37 MUSTER 63.89 54.13 75.00 76.63 70.86 82.96 75.62 72.12 69.14 0.27 0.19 0.48 0.37 0.41 0.73 0.34 0.60 0.36 64.32 55.77 75.00 76.63 71.41 82.96 75.62 73.15 69.14 0.26 0.49 0.47 0.18 0.29 0.65 0.26 0.55 0.31 MUSTER 37
38 nFOLD3 63.89 52.63 74.52 76.63 69.06 82.93 75.00 63.07 67.69 0.27 -0.18 0.42 0.37 -0.06 0.73 0.28 -0.20 0.17 63.89 54.77 74.52 76.63 69.72 82.93 75.00 67.80 67.69 0.16 0.18 0.39 0.18 -0.20 0.64 0.18 -0.01 0.04 nFOLD3 38
39 HHpred4 63.67 53.63 74.15 75.82 65.58 82.90 74.69 70.99 66.81 0.23 0.07 0.38 0.08 -0.95 0.72 0.25 0.50 0.05 63.67 53.63 74.15 75.82 65.58 82.90 74.69 70.99 66.81 0.11 -0.17 0.33 -0.15 -1.40 0.63 0.14 0.32 -0.12 HHpred4 39
40 HHpred2 63.67 53.63 74.15 75.82 65.58 82.90 74.69 70.99 66.81 0.23 0.07 0.38 0.08 -0.95 0.72 0.25 0.50 0.05 63.67 53.63 74.15 75.82 65.58 82.90 74.69 70.99 66.81 0.11 -0.17 0.33 -0.15 -1.40 0.63 0.14 0.32 -0.12 HHpred2 40
41 HHpred5 63.67 53.63 74.15 75.82 65.58 82.90 74.69 70.99 66.81 0.23 0.07 0.38 0.08 -0.95 0.72 0.25 0.50 0.05 63.67 53.63 74.15 75.82 65.58 82.90 74.69 70.99 66.81 0.11 -0.17 0.33 -0.15 -1.40 0.63 0.14 0.32 -0.12 HHpred5 41
42 FFASstandard 63.57 53.17 72.82 75.33 69.12 79.24 76.85 73.97 70.45 0.21 -0.04 0.22 -0.08 -0.04 -0.19 0.46 0.76 0.54 64.10 55.13 72.82 75.49 70.59 79.24 77.16 73.97 70.67 0.21 0.29 0.12 -0.29 0.05 -0.47 0.46 0.64 0.60 FFASstandard 42
43 FUGUE_KM 63.46 55.34 69.86 74.51 68.74 76.26 75.62 69.44 69.05 0.19 0.49 -0.14 -0.37 -0.14 -0.94 0.34 0.36 0.35 63.46 55.34 69.86 74.51 68.74 76.26 75.62 69.44 69.05 0.06 0.36 -0.35 -0.70 -0.49 -1.37 0.26 0.16 0.30 FUGUE_KM 43
44 FEIG 63.03 52.42 70.46 74.84 66.61 78.41 71.61 65.43 65.15 0.10 -0.23 -0.06 -0.25 -0.69 -0.40 -0.04 0.01 -0.17 65.17 56.62 74.70 77.45 73.47 82.82 76.23 65.95 68.50 0.45 0.75 0.42 0.53 0.88 0.61 0.34 -0.21 0.19 FEIG 44
45 Pcons_multi 62.93 52.88 71.68 74.51 70.70 78.60 75.93 71.81 68.73 0.08 -0.12 0.08 -0.37 0.37 -0.35 0.37 0.57 0.31 62.93 52.88 73.12 74.67 70.70 81.00 76.23 72.53 69.43 -0.06 -0.39 0.17 -0.63 0.08 0.06 0.34 0.48 0.37 Pcons_multi 45
46 3D−JIGSAW_V3 62.82 53.31 72.69 74.18 68.30 79.61 73.77 70.89 69.02 0.06 -0.01 0.20 -0.48 -0.25 -0.10 0.17 0.49 0.35 63.14 53.38 72.69 74.51 68.30 79.61 74.69 72.43 69.09 -0.01 -0.24 0.10 -0.70 -0.61 -0.36 0.14 0.47 0.30 3D−JIGSAW_V3 46
47 mGenTHREADER 62.71 53.95 69.69 73.69 67.70 75.60 76.23 66.15 69.07 0.04 0.15 -0.16 -0.65 -0.41 -1.10 0.40 0.07 0.35 62.71 53.95 69.69 73.69 67.70 75.60 76.23 66.15 69.07 -0.11 -0.07 -0.38 -1.04 -0.79 -1.57 0.34 -0.19 0.30 mGenTHREADER 47
48 circle 62.39 54.13 71.67 74.35 69.34 78.07 76.85 66.77 69.93 -0.02 0.19 0.08 -0.42 0.01 -0.49 0.46 0.12 0.47 64.64 55.34 74.06 77.78 75.05 82.57 76.85 72.02 69.93 0.33 0.36 0.32 0.66 1.34 0.53 0.42 0.43 0.46 circle 48
49 PS2−server 62.18 53.13 72.51 74.02 65.09 79.06 77.47 74.79 69.29 -0.06 -0.05 0.18 -0.54 -1.08 -0.24 0.52 0.83 0.38 62.18 53.13 72.51 74.02 66.18 79.06 77.47 74.79 69.29 -0.23 -0.32 0.07 -0.90 -1.23 -0.53 0.50 0.72 0.34 PS2−server 49
50 FALCON_CONSENSUS 61.86 50.89 71.99 73.69 66.94 79.64 76.23 73.15 68.08 -0.12 -0.61 0.12 -0.65 -0.60 -0.09 0.40 0.69 0.22 61.86 50.89 71.99 73.69 66.94 79.64 76.23 73.35 68.08 -0.30 -1.00 -0.01 -1.04 -1.01 -0.35 0.34 0.57 0.12 FALCON_CONSENSUS 50
51 FALCON 61.86 50.75 71.82 73.69 66.94 79.38 76.23 72.94 68.08 -0.12 -0.64 0.10 -0.65 -0.60 -0.16 0.40 0.67 0.22 62.07 51.10 71.99 73.69 66.94 79.64 76.23 73.35 68.08 -0.26 -0.94 -0.01 -1.04 -1.01 -0.35 0.34 0.57 0.12 FALCON 51
52 METATASSER 61.65 51.00 71.41 73.86 67.97 78.62 71.91 67.39 66.97 -0.16 -0.58 0.05 -0.59 -0.34 -0.35 -0.01 0.18 0.07 66.99 57.02 74.66 80.23 75.98 83.30 75.31 72.33 68.64 0.86 0.87 0.41 1.69 1.61 0.75 0.22 0.46 0.22 METATASSER 52
53 Distill 61.43 51.50 68.23 71.57 63.89 72.88 74.69 67.90 69.54 -0.20 -0.46 -0.33 -1.39 -1.39 -1.78 0.25 0.22 0.42 62.07 51.50 71.08 73.53 69.83 76.05 74.69 67.90 70.39 -0.26 -0.81 -0.16 -1.11 -0.17 -1.43 0.14 -0.00 0.55 Distill 53
54 YASARA 60.58 50.93 69.35 75.98 67.05 78.40 60.49 51.65 62.55 -0.36 -0.60 -0.20 0.14 -0.57 -0.40 -1.09 -1.21 -0.52 60.79 51.92 69.64 76.80 67.05 80.20 61.42 55.45 62.59 -0.55 -0.69 -0.38 0.25 -0.97 -0.18 -1.59 -1.31 -0.91 YASARA 54
55 OLGAFS 60.15 52.03 66.40 74.67 64.76 77.38 60.19 44.55 55.86 -0.44 -0.33 -0.55 -0.31 -1.16 -0.66 -1.12 -1.84 -1.42 60.15 52.03 66.40 74.67 64.76 77.38 60.19 44.55 55.86 -0.69 -0.65 -0.90 -0.63 -1.64 -1.03 -1.75 -2.45 -2.16 OLGAFS 55
56 Pushchino 60.04 51.78 67.75 73.37 63.13 75.66 67.28 58.02 62.79 -0.47 -0.39 -0.39 -0.76 -1.58 -1.09 -0.45 -0.65 -0.49 60.04 51.78 67.75 73.37 63.13 75.66 67.28 58.02 62.79 -0.72 -0.73 -0.69 -1.18 -2.11 -1.55 -0.83 -1.04 -0.87 Pushchino 56
57 SAM−T06−server 59.51 51.60 70.52 74.35 70.10 80.88 61.11 52.67 59.93 -0.57 -0.43 -0.06 -0.42 0.21 0.21 -1.04 -1.12 -0.87 60.79 51.60 70.52 74.35 70.10 80.88 66.05 55.76 59.93 -0.55 -0.78 -0.24 -0.77 -0.09 0.02 -0.99 -1.27 -1.40 SAM−T06−server 57
58 LOOPP_Server 59.40 51.00 68.98 73.04 61.82 77.58 63.89 53.60 62.17 -0.59 -0.58 -0.24 -0.88 -1.92 -0.61 -0.77 -1.04 -0.57 59.40 51.00 68.98 73.04 63.89 77.58 63.89 53.60 62.17 -0.86 -0.97 -0.49 -1.31 -1.89 -0.97 -1.27 -1.50 -0.99 LOOPP_Server 58
59 3Dpro 45.73 42.06 45.62 69.94 64.33 73.60 15.12 14.92 10.84 -3.19 -2.80 -3.04 -1.95 -1.28 -1.60 -5.40 -4.46 -7.45 47.01 45.37 47.79 71.89 69.39 78.23 15.12 14.92 11.69 -3.68 -2.68 -3.86 -1.79 -0.30 -0.78 -7.64 -5.56 -10.38 3Dpro 59
60 panther_server 43.16 39.39 31.07 66.01 60.24 64.49 0.00 0.00 -11.37 -3.68 -3.46 -4.79 -3.31 -2.33 -3.88 -6.84 -5.77 -10.43 61.43 52.28 68.08 73.69 65.25 74.97 72.84 62.14 66.38 -0.40 -0.58 -0.63 -1.04 -1.50 -1.76 -0.10 -0.61 -0.20 panther_server 60
61 Fiser−M4T 43.06 40.42 33.41 65.85 61.82 68.01 0.00 0.00 -11.37 -3.70 -3.20 -4.51 -3.37 -1.92 -3.00 -6.84 -5.77 -10.43 43.06 40.42 33.41 65.85 61.82 68.01 0.00 0.00 -11.37 -4.58 -4.19 -6.15 -4.31 -2.49 -3.86 -9.61 -7.12 -14.68 Fiser−M4T 61
62 FOLDpro 42.52 36.33 41.49 65.03 55.66 67.90 14.81 14.61 10.29 -3.80 -4.22 -3.54 -3.65 -3.51 -3.02 -5.43 -4.48 -7.52 42.52 36.33 41.49 65.03 55.66 67.90 14.81 14.61 11.69 -4.71 -5.44 -4.87 -4.65 -4.27 -3.89 -7.68 -5.59 -10.38 FOLDpro 62
63 Frankenstein 38.78 34.51 39.08 59.64 53.10 64.75 13.58 12.76 9.41 -4.51 -4.67 -3.83 -5.52 -4.17 -3.81 -5.55 -4.65 -7.64 40.28 37.00 40.52 61.60 56.59 66.93 13.89 13.89 9.41 -5.22 -5.23 -5.02 -6.08 -4.00 -4.18 -7.80 -5.67 -10.81 Frankenstein 63
64 rehtnap 31.62 29.27 21.04 48.20 44.61 43.90 10.80 10.19 -2.00 -5.88 -5.97 -5.99 -9.48 -6.35 -9.01 -5.81 -4.87 -9.17 31.62 29.27 33.17 48.37 44.61 43.90 49.69 36.52 36.14 -7.19 -7.59 -6.19 -11.60 -7.46 -11.13 -3.12 -3.29 -5.83 rehtnap 64
65 MUFOLD−Server 18.16 16.59 16.18 20.43 16.18 17.72 38.58 28.50 32.26 -8.44 -9.11 -6.58 -19.10 -13.68 -15.55 -3.18 -3.26 -4.58 45.94 31.77 50.26 69.61 47.71 69.84 38.58 28.50 33.25 -3.93 -6.83 -3.47 -2.74 -6.57 -3.31 -4.57 -4.13 -6.37 MUFOLD−Server 65
66 RBO−Proteus 14.53 12.32 37.07 16.18 14.11 32.40 41.67 35.29 63.11 -9.13 -10.16 -4.07 -20.57 -14.21 -11.88 -2.88 -2.66 -0.45 15.49 13.00 38.21 17.16 16.29 33.55 45.06 37.45 64.20 -10.86 -12.55 -5.39 -24.62 -15.65 -14.25 -3.73 -3.19 -0.61 RBO−Proteus 66
67 MUFOLD−MD 13.25 11.04 33.04 18.63 15.25 32.84 34.26 28.70 51.33 -9.38 -10.48 -4.55 -19.72 -13.92 -11.77 -3.59 -3.24 -2.02 14.42 12.00 36.23 19.93 18.52 38.60 35.80 30.25 51.33 -11.10 -12.85 -5.70 -23.46 -15.01 -12.73 -4.94 -3.95 -3.00 MUFOLD−MD 67
68 mariner1 13.14 10.58 0.63 20.10 16.18 18.76 0.00 0.00 -11.37 -9.40 -10.60 -8.44 -19.21 -13.68 -15.29 -6.84 -5.77 -10.43 42.73 40.46 30.37 65.36 61.87 63.45 28.09 20.27 33.58 -4.66 -4.18 -6.64 -4.52 -2.47 -5.23 -5.94 -5.00 -6.31 mariner1 68
69 forecast 11.64 9.62 20.05 16.67 14.27 25.16 27.47 24.07 28.93 -9.68 -10.83 -6.11 -20.40 -14.17 -13.69 -4.23 -3.65 -5.03 12.71 11.15 23.07 18.79 15.90 27.89 28.39 24.90 32.36 -11.49 -13.11 -7.80 -23.94 -15.77 -15.96 -5.90 -4.51 -6.54 forecast 69
70 RANDOM 9.36 8.08 9.36 13.10 11.10 13.10 24.45 19.95 24.45 -10.12 -11.22 -7.40 -21.64 -14.98 -16.70 -4.52 -4.01 -5.63 9.36 8.08 9.36 13.10 11.10 13.10 24.45 19.95 24.45 -12.25 -14.05 -9.98 -26.31 -17.15 -20.42 -6.42 -5.03 -8.01 RANDOM 70
71 BHAGEERATH                                                       -10.12 -11.22 -7.40 -21.64 -14.98 -16.70 -4.52 -4.01 -5.63                                                       -12.25 -14.05 -9.98 -26.31 -17.15 -20.42 -6.42 -5.03 -8.01 BHAGEERATH 71
72 mahmood−torda−server                                                       -10.12 -11.22 -7.40 -21.64 -14.98 -16.70 -4.52 -4.01 -5.63                                                       -12.25 -14.05 -9.98 -26.31 -17.15 -20.42 -6.42 -5.03 -8.01 mahmood−torda−server 72
73 schenk−torda−server                                                       -10.12 -11.22 -7.40 -21.64 -14.98 -16.70 -4.52 -4.01 -5.63                                                       -12.25 -14.05 -9.98 -26.31 -17.15 -20.42 -6.42 -5.03 -8.01 schenk−torda−server 73
74 test_http_server_01                                                       -10.12 -11.22 -7.40 -21.64 -14.98 -16.70 -4.52 -4.01 -5.63                                                       -12.25 -14.05 -9.98 -26.31 -17.15 -20.42 -6.42 -5.03 -8.01 test_http_server_01 74