T0395

X-ray Targets
387 388 389 390
391 392 393 394
395 396 397 398
399 400 401 402
403 404 405 406
407 408 409 410
411 412 413 414
415 416 417 418
419 420 421 422
423 424 425 426
427 428 429 430
431 432 433 434
435 436 438 439
440 441 442 443
444 445 446 447
448 449 450 451
452 453 454 455
456 457 458 459
461 463 465 470
477 478 479 481
483 485 486 487
488 489 490 491
493 494 495 496
497 501 502 503
504 505 506 507
508 509 510 511
512 513 514

T0395

Flavin_MAT Candida glabrata

Target type: Human/Server

Target sequence:

>T0395 Flavin_MAT, Candida glabrata, 304 residues
MRLGDAAELCYNLTSSYLQIAAESDSIIAQTQRAINTTKSILINETFPKWSPLNGEISFSYNGGKDCQVLLLLYLSCLWEYYIVKLSQSQFDGKFHRFPLTKLPTVFIDHDDTFKTLENFIEETSLRYSLSLYESDRDKCETMAEAFETFLQVFPETKAIVIGIRHTDPFGEHLKPIQKTDANWPDFYRLQPLLHWNLANIWSFLLYSNEPICELYRYGFTSLGNVEETLPNPHLRKDKNSTPLKLNFEWEIENRYKHNEVTKAEPIPIADEDLVKIENLHEDYYPGWYLVDDKLERAGRIKKK

Structure:
Method: X-ray, res=Å, R/Rfree=Null/Null
Determined by:
PDB ID:

395 cartoon
Cartoon diagram of 395: chain A

PyMOL of T0395 unreleased PDB

Domains:  PyMOL of domains

Two domains. Residue ranges in PDB: 1-210 and 211-304. Residue ranges in target: 1-210 and 211-304.

395 domain evaluation plot
Correlation between weighted by the number of residues sum of GDT-TS scores for domain-based evlatuation (y, vertical axis) and whole chain GDT-TS (x, horizontal axis).

To compute the weighted sum, GDT-TS for each domain was multiplied by the domain length, and this sum was divided by the sum of domain lengths. Each point represents first server model. Green, gray and black points are top 10, bottom 25% and the rest of prediction models. Blue line is the best-fit slope line (intersection 0) to the top 10 server models. Red line is the diagonal. Slope and root mean square y-x distance for the top 10 models (average difference between the weighted sum of domain GDT-TS scores and the whole chain GDT-TS score) are shown above the plot.

Structure classification:

Adenine nucleotide alpha hydrolase fold with a C-terminal "cap" domain of loosely defined packing and topology. This C-domain houses a couple of active site residues near its very C-terminus. This domain is present in most homologs, but is much shorter and lacks the "belt ring" of two α-helices and a long loop between them (residues 236-284). Only 1zun sequence has a longer version, but it appears disordered in crystals.

CASP category:

Whole chain: .

1st domain: . 2nd domain: .

Closest templates:

1zun, 1sur, 2oq2, 2goy, 2o8v.

Target sequence - PDB file inconsistencies:

T0395    PDB unreleased    T0395.pdb    PyMOL    PyMOL of domains    

T0395    1 MRLGDAAELCYNLTSSYLQIAAESDSIIAQTQRAINTTKSILINETFPKWSPLNGEISFSYNGGKDCQVLLLLYLSCLWEYYIVKLSQSQFDGKFHRFPLTKLPTVFIDHDDTFKTLENFIEETSLRYSLSLYESDRDKCETMAEAFETFLQVFPETKAIVIGIRHTDPFGEHLKPIQKTDANWPDFYRLQPLLHWNLANIWSFLLYSNEPICELYRYGFTSLGNVEETLPNPHLRKDKNSTPLKLNFEWEIENRYKHNEVTKAEPIPIADEDLVKIENLHEDYYPGWYLVDDKLERAGRIKKK 304
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~~~~~~~~~~~|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
xxxxA    1 MRLGDAAELCYNLTSSYLQIAAESDSIIAQTQRAINTTKSILINETFPKWSPLNGEISFSYNGGKDCQVLLLLYLSCLWEYYIVKL-----------------PTVFIDHDDTFKTLENFIEETSLRYSLSLYESDRDKCETMAEAFETFLQVFPETKAIVIGIRHTDPFGEHLKPIQKTDANWPDFYRLQPLLHWNLANIWSFLLYSNEPICELYRYGFTSLGNVEETLPNPHLRKDKNSTPLKLNFEWEIENRYKHNEVTKAEPIPIADEDLVKIENLHEDYYPGWYLVDDKLERAGRIKKK 304

We suggest to evaluate this target as a single domain spanning whole chain. However, evolutionarily this is a 2-domain protein:

1st domain: target 1-86, 104-197 ; pdb 1-103, 104-197

2nd domain: target 198-304 ; pdb 198-304

T0395    PDB unreleased    T0395.pdb    PyMOL    PyMOL of domains    

T0395    1 MRLGDAAELCYNLTSSYLQIAAESDSIIAQTQRAINTTKSILINETFPKWSPLNGEISFSYNGGKDCQVLLLLYLSCLWEYYIVKLSQSQFDGKFHRFPLTKLPTVFIDHDDTFKTLENFIEETSLRYSLSLYESDRDKCETMAEAFETFLQVFPETKAIVIGIRHTDPFGEHLKPIQKTDANWPDFYRLQPLLHWNLANIWSFLLYSNEPICELYRYGFTSLGNVEETLPNPHLRKDKNSTPLKLNFEWEIENRYKHNEVTKAEPIPIADEDLVKIENLHEDYYPGWYLVDDKLERAGRIKKK 304
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~~~~~~~~~~~|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
xxxxA    1 MRLGDAAELCYNLTSSYLQIAAESDSIIAQTQRAINTTKSILINETFPKWSPLNGEISFSYNGGKDCQVLLLLYLSCLWEYYIVKL-----------------PTVFIDHDDTFKTLENFIEETSLRYSLSLYESDRDKCETMAEAFETFLQVFPETKAIVIGIRHTDPFGEHLKPIQKTDANWPDFYRLQPLLHWNLANIWSFLLYSNEPICELYRYGFTSLGNVEETLPNPHLRKDKNSTPLKLNFEWEIENRYKHNEVTKAEPIPIADEDLVKIENLHEDYYPGWYLVDDKLERAGRIKKK 304

We suggest to evaluate this target as a single domain spanning whole chain. However, evolutionarily this is a 2-domain protein:

1st domain: target 1-86, 104-197 ; pdb 1-103, 104-197

2nd domain: target 198-304 ; pdb 198-304

Sequence classification:

Phosphoadenosine phosphosulfate reductase family PAPS_reduct in Pfam.

Server predictions:

T0395:pdb 1-304:seq 1-304:FR;   alignment

distribution of first scores
First models for T0395: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

395_1:pdb 1-197:seq 1-197:CM_hard;   alignment

distribution of first scores
First models for T0395_1: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

395_2:pdb 198-304:seq 198-304:FR;   alignment

distribution of first scores
First models for T0395_2: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

# GROUP ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ ↓ GROUP #
T0395 395_1 395_2 T0395 395_1 395_2 T0395 395_1 395_2 T0395 395_1 395_2
First score First Z-score Best score Best Z-score
1 DBAKER 49.39 43.00 49.23 59.58 54.31 55.51 47.66 42.84 48.71 2.08 1.98 2.03 1.77 2.04 1.49 3.70 3.35 3.14 49.39 43.00 50.00 59.58 54.31 58.00 47.66 42.84 48.71 2.21 1.93 2.00 1.73 1.89 1.56 3.96 3.21 3.44 DBAKER 1
2 IBT_LT 47.21 42.57 45.12 56.81 52.45 55.72 39.95 34.19 35.62 1.77 1.91 1.57 1.47 1.83 1.51 2.23 1.67 1.37 47.21 42.57 45.12 56.81 52.45 55.72 39.95 34.19 35.62 1.81 1.85 1.40 1.36 1.64 1.29 2.16 1.29 1.23 IBT_LT 2
3 LEE 44.08 39.43 45.32 56.81 52.45 56.39 32.94 32.16 34.90 1.34 1.45 1.60 1.47 1.83 1.59 0.90 1.27 1.27 44.08 39.49 45.50 56.94 52.73 56.69 32.94 32.16 34.90 1.23 1.28 1.44 1.38 1.67 1.40 0.52 0.84 1.11 LEE 3
4 HHpred5 43.99 38.59 39.08 54.58 49.40 50.21 32.01 28.43 29.34 1.33 1.33 0.90 1.24 1.49 0.91 0.72 0.55 0.52 43.99 38.59 39.08 54.58 49.40 50.21 32.01 28.43 29.34 1.22 1.11 0.65 1.06 1.23 0.63 0.30 0.02 0.17 HHpred5 4
5 HHpred4 43.81 39.34 38.98 54.86 45.14 50.00 32.24 31.93 28.16 1.30 1.44 0.89 1.27 1.01 0.88 0.76 1.23 0.36 43.81 39.34 38.98 54.86 45.14 50.00 32.24 31.93 28.16 1.18 1.25 0.64 1.10 0.66 0.60 0.36 0.79 -0.03 HHpred4 5
6 LEE−SERVER 43.47 39.46 40.86 54.03 49.31 51.04 32.24 30.45 31.56 1.25 1.45 1.10 1.18 1.48 1.00 0.76 0.94 0.82 44.08 39.46 41.60 55.14 49.35 52.11 32.48 30.45 32.33 1.23 1.28 0.96 1.14 1.22 0.86 0.41 0.47 0.67 LEE−SERVER 6
7 McGuffin 43.03 38.09 41.17 53.61 49.35 51.97 32.24 28.50 30.89 1.19 1.25 1.13 1.14 1.48 1.10 0.76 0.56 0.73 43.55 39.46 41.60 54.31 49.35 52.11 32.48 30.53 31.88 1.14 1.28 0.96 1.03 1.22 0.86 0.41 0.48 0.60 McGuffin 7
8 SAMUDRALA 42.51 39.72 38.89 52.78 48.06 50.54 32.24 31.78 26.83 1.12 1.49 0.88 1.05 1.34 0.94 0.76 1.20 0.18 43.47 39.72 40.13 54.03 49.49 52.27 32.24 31.85 28.92 1.12 1.32 0.78 0.99 1.24 0.88 0.36 0.78 0.10 SAMUDRALA 8
9 SAM−T08−server 42.51 34.12 46.55 55.69 46.62 59.56 29.44 27.73 33.12 1.12 0.67 1.73 1.36 1.17 1.94 0.23 0.41 1.03 44.60 37.11 46.55 55.69 47.92 59.56 34.35 31.54 33.12 1.33 0.84 1.57 1.21 1.03 1.75 0.85 0.71 0.81 SAM−T08−server 9
10 MULTICOM 42.42 39.23 44.89 52.64 46.44 57.04 32.71 27.73 33.03 1.11 1.42 1.55 1.03 1.15 1.66 0.85 0.41 1.02 43.47 39.23 44.89 54.86 47.27 57.04 37.15 36.68 34.03 1.12 1.23 1.37 1.10 0.95 1.44 1.51 1.84 0.96 MULTICOM 10
11 Bates_BMM 42.42 37.31 46.80 53.33 47.78 59.86 32.48 27.80 33.34 1.11 1.14 1.76 1.11 1.30 1.97 0.81 0.43 1.06 42.60 39.72 46.80 53.33 47.96 59.86 32.48 29.67 33.51 0.96 1.32 1.60 0.90 1.04 1.78 0.41 0.29 0.87 Bates_BMM 11
12 Zhang 42.42 36.56 44.03 53.33 47.04 57.61 30.61 27.49 29.69 1.11 1.03 1.45 1.11 1.22 1.72 0.45 0.37 0.57 42.42 37.02 46.53 53.33 47.04 60.34 33.88 31.46 33.79 0.93 0.82 1.57 0.90 0.92 1.84 0.74 0.69 0.92 Zhang 12
13 ZicoFullSTP 42.25 38.99 44.77 52.78 46.30 57.07 32.71 28.50 32.69 1.09 1.39 1.53 1.05 1.14 1.66 0.85 0.56 0.97 43.03 38.99 44.77 53.89 48.70 57.07 32.71 29.83 36.15 1.04 1.19 1.35 0.97 1.14 1.45 0.47 0.33 1.32 ZicoFullSTP 13
14 SAM−T08−human 42.16 36.47 46.89 54.86 49.03 60.98 25.93 25.78 32.10 1.07 1.01 1.77 1.27 1.45 2.09 -0.44 0.03 0.89 43.38 39.08 47.14 55.83 50.14 60.98 32.24 27.65 35.11 1.10 1.21 1.65 1.23 1.33 1.92 0.36 -0.15 1.14 SAM−T08−human 14
15 BAKER−ROBETTA 42.07 37.48 44.53 52.78 47.31 56.55 32.24 27.57 32.98 1.06 1.16 1.51 1.05 1.25 1.60 0.76 0.38 1.01 43.55 38.21 44.53 52.78 49.21 56.55 37.38 37.07 34.05 1.14 1.04 1.32 0.82 1.21 1.39 1.56 1.93 0.96 BAKER−ROBETTA 15
16 MULTICOM−REFINE 42.07 35.51 40.47 52.64 44.49 49.36 32.71 30.06 33.57 1.06 0.87 1.06 1.03 0.93 0.81 0.85 0.87 1.09 42.33 36.67 40.84 52.64 44.86 49.93 32.94 31.00 33.92 0.91 0.76 0.87 0.80 0.62 0.60 0.52 0.59 0.94 MULTICOM−REFINE 16
17 MUProt 42.07 35.51 40.47 52.64 44.49 49.36 32.71 30.06 33.57 1.06 0.87 1.06 1.03 0.93 0.81 0.85 0.87 1.09 42.16 37.72 40.47 52.64 44.49 49.98 32.71 31.00 33.57 0.88 0.95 0.82 0.80 0.58 0.60 0.47 0.59 0.88 MUProt 17
18 GeneSilico 41.55 37.25 43.14 50.56 43.94 55.44 33.18 30.06 32.34 0.99 1.13 1.35 0.81 0.87 1.48 0.94 0.87 0.93 42.68 37.86 45.46 51.53 46.62 59.21 33.18 30.22 32.34 0.98 0.98 1.44 0.66 0.86 1.70 0.58 0.42 0.68 GeneSilico 18
19 Phyre_de_novo 41.55 36.50 38.96 56.53 49.77 56.02 21.26 19.78 21.06 0.99 1.02 0.89 1.44 1.53 1.55 -1.33 -1.13 -0.60 41.99 37.43 38.96 56.53 49.77 56.02 33.41 32.01 30.63 0.85 0.90 0.63 1.32 1.28 1.32 0.63 0.81 0.39 Phyre_de_novo 19
20 MidwayFolding 41.46 37.11 42.21 50.00 45.19 52.11 36.45 33.18 34.81 0.98 1.11 1.25 0.75 1.01 1.12 1.57 1.47 1.26 41.46 37.11 42.21 50.00 45.19 52.11 36.45 33.18 34.81 0.75 0.84 1.04 0.45 0.67 0.86 1.34 1.07 1.09 MidwayFolding 20
21 RAPTOR 41.46 36.12 37.61 51.39 40.46 47.63 31.78 30.06 28.35 0.98 0.96 0.74 0.90 0.48 0.62 0.67 0.87 0.39 41.46 36.61 37.61 53.75 45.09 47.71 33.88 33.41 28.35 0.75 0.75 0.47 0.95 0.66 0.33 0.74 1.12 0.00 RAPTOR 21
22 FAMS−multi 41.29 36.56 39.00 52.36 45.05 48.83 31.07 28.74 30.27 0.95 1.03 0.89 1.00 1.00 0.76 0.54 0.61 0.65 41.29 37.43 39.00 52.36 45.37 48.83 32.48 28.74 30.27 0.72 0.90 0.64 0.77 0.69 0.46 0.41 0.09 0.33 FAMS−multi 22
23 Elofsson 41.20 36.91 40.68 50.83 43.52 49.65 32.94 28.82 33.62 0.94 1.08 1.08 0.84 0.82 0.85 0.90 0.63 1.10 41.73 37.95 41.47 51.81 45.60 51.03 32.94 31.46 33.62 0.80 1.00 0.94 0.69 0.72 0.73 0.52 0.69 0.89 Elofsson 23
24 CpHModels 41.20 34.12 32.47 51.39 41.67 44.19 33.41 31.70 20.64 0.94 0.67 0.17 0.90 0.61 0.24 0.99 1.18 -0.65 41.20 34.12 32.47 51.39 41.67 44.19 33.41 31.70 20.64 0.70 0.29 -0.17 0.64 0.20 -0.09 0.63 0.74 -1.30 CpHModels 24
25 Zico 41.12 35.54 42.99 52.22 43.06 53.58 31.07 25.16 34.10 0.93 0.88 1.34 0.99 0.77 1.28 0.54 -0.09 1.16 43.03 38.99 44.77 53.89 48.70 57.07 32.71 29.83 36.15 1.04 1.19 1.35 0.97 1.14 1.45 0.47 0.33 1.32 Zico 25
26 ZicoFullSTPFullData 41.12 35.54 42.99 52.22 43.06 53.58 31.07 25.16 34.10 0.93 0.88 1.34 0.99 0.77 1.28 0.54 -0.09 1.16 43.55 39.14 42.99 54.31 49.68 54.32 32.48 29.83 34.10 1.14 1.22 1.13 1.03 1.27 1.12 0.41 0.33 0.97 ZicoFullSTPFullData 26
27 PS2−manual 41.03 35.98 34.38 51.67 45.56 48.89 31.31 25.70 16.89 0.92 0.94 0.38 0.93 1.05 0.76 0.58 0.02 -1.16 41.03 35.98 34.38 53.61 46.20 48.89 31.31 25.70 16.89 0.67 0.63 0.07 0.93 0.80 0.47 0.14 -0.59 -1.93 PS2−manual 27
28 Jones−UCL 41.03 35.25 34.13 50.14 40.14 47.56 33.65 31.31 18.73 0.92 0.83 0.35 0.77 0.44 0.62 1.03 1.11 -0.91 41.03 35.25 34.13 50.14 40.14 47.56 33.65 31.31 18.73 0.67 0.50 0.04 0.47 -0.01 0.31 0.69 0.66 -1.62 Jones−UCL 28
29 3DShotMQ 41.03 34.87 38.34 51.53 42.45 49.50 31.07 26.48 27.99 0.92 0.78 0.82 0.92 0.70 0.83 0.54 0.17 0.34 41.03 34.87 38.34 51.53 42.45 49.50 31.07 26.48 27.99 0.67 0.43 0.56 0.66 0.30 0.54 0.09 -0.41 -0.06 3DShotMQ 29
30 Sternberg 41.03 34.78 37.36 55.97 48.47 53.95 21.03 19.70 20.96 0.92 0.76 0.71 1.39 1.38 1.32 -1.38 -1.15 -0.61 41.03 34.78 37.36 55.97 48.47 53.95 21.03 19.70 20.96 0.67 0.41 0.44 1.25 1.11 1.08 -2.26 -1.91 -1.24 Sternberg 30
31 Pcons_local 40.68 36.15 26.02 52.78 46.39 43.34 29.91 29.59 3.77 0.87 0.97 -0.55 1.05 1.15 0.15 0.32 0.77 -2.93 40.77 36.15 26.41 52.78 46.39 43.34 32.94 31.23 11.10 0.63 0.66 -0.92 0.82 0.83 -0.19 0.52 0.64 -2.91 Pcons_local 31
32 pipe_int 40.68 36.03 40.10 50.00 40.93 49.46 34.81 29.52 32.90 0.87 0.95 1.02 0.75 0.53 0.82 1.25 0.76 1.00 40.68 36.03 40.10 50.00 40.93 49.46 34.81 29.52 32.90 0.61 0.64 0.78 0.45 0.10 0.54 0.96 0.26 0.77 pipe_int 32
33 Poing 40.33 36.61 37.93 51.67 45.28 46.40 28.04 21.81 31.86 0.82 1.03 0.77 0.93 1.02 0.49 -0.04 -0.74 0.86 40.42 36.70 38.22 51.81 45.42 47.21 28.97 28.82 31.86 0.56 0.76 0.54 0.69 0.70 0.27 -0.41 0.11 0.59 Poing 33
34 Phyre2 40.16 35.80 35.78 50.97 43.75 46.95 27.80 27.34 24.45 0.80 0.91 0.54 0.86 0.85 0.55 -0.09 0.34 -0.14 41.99 37.43 37.56 50.97 43.75 46.95 33.41 32.01 30.63 0.85 0.90 0.46 0.58 0.48 0.24 0.63 0.81 0.39 Phyre2 34
35 Phragment 40.07 36.12 38.46 51.11 43.52 47.42 25.23 24.45 31.41 0.78 0.96 0.83 0.87 0.82 0.60 -0.58 -0.22 0.80 40.42 36.67 39.21 51.11 43.52 47.69 28.04 27.88 33.68 0.56 0.76 0.67 0.60 0.45 0.33 -0.62 -0.10 0.90 Phragment 35
36 COMA−M 39.98 35.57 28.69 51.39 43.61 48.89 26.64 26.48 0.80 0.77 0.88 -0.25 0.90 0.83 0.76 -0.31 0.17 -3.33 39.98 35.57 28.69 51.53 43.66 48.89 26.64 26.48 0.80 0.48 0.56 -0.64 0.66 0.46 0.47 -0.95 -0.41 -4.64 COMA−M 36
37 3DShot2 39.72 31.24 28.02 49.58 38.29 34.80 32.24 31.00 25.87 0.73 0.24 -0.33 0.71 0.23 -0.79 0.76 1.05 0.05 39.72 31.24 28.02 49.58 38.29 34.80 32.24 31.00 25.87 0.43 -0.25 -0.72 0.40 -0.25 -1.21 0.36 0.59 -0.42 3DShot2 37
38 COMA 39.55 34.44 33.71 47.22 38.70 44.54 34.11 32.87 22.84 0.71 0.71 0.31 0.46 0.28 0.28 1.12 1.41 -0.36 41.12 36.82 33.85 48.89 43.43 48.89 35.51 32.87 26.24 0.69 0.79 0.00 0.31 0.43 0.47 1.12 1.00 -0.35 COMA 38
39 FEIG 39.55 33.04 43.64 53.61 44.07 55.77 25.93 24.61 32.87 0.71 0.51 1.41 1.14 0.88 1.52 -0.44 -0.19 1.00 41.46 36.53 46.09 56.11 50.00 57.85 27.10 24.61 35.61 0.75 0.73 1.52 1.27 1.31 1.54 -0.84 -0.83 1.23 FEIG 39
40 METATASSER 39.29 33.13 42.96 50.14 43.01 53.36 27.57 23.99 35.70 0.67 0.52 1.33 0.77 0.77 1.25 -0.13 -0.31 1.38 41.81 34.49 43.40 52.08 43.01 53.89 31.54 28.74 35.70 0.82 0.36 1.18 0.73 0.38 1.07 0.19 0.09 1.24 METATASSER 40
41 fams−ace2 38.76 32.09 42.56 50.14 41.90 52.48 27.34 23.75 36.18 0.60 0.37 1.29 0.77 0.64 1.16 -0.17 -0.36 1.44 43.38 38.04 42.56 53.75 49.03 52.48 32.24 29.59 36.18 1.10 1.01 1.08 0.95 1.18 0.90 0.36 0.28 1.32 fams−ace2 41
42 mGenTHREADER 38.50 34.44 24.32 47.22 38.52 34.99 30.84 30.68 12.45 0.57 0.71 -0.74 0.46 0.26 -0.77 0.49 0.99 -1.76 38.50 34.44 24.32 47.22 38.52 34.99 30.84 30.68 12.45 0.21 0.35 -1.18 0.08 -0.22 -1.19 0.03 0.52 -2.68 mGenTHREADER 42
43 circle 38.41 33.54 24.53 46.81 41.99 37.02 31.54 25.16 11.43 0.55 0.58 -0.71 0.42 0.65 -0.54 0.63 -0.09 -1.90 39.20 35.02 31.24 48.47 42.96 39.89 32.24 28.11 25.58 0.34 0.45 -0.32 0.25 0.37 -0.60 0.36 -0.05 -0.47 circle 43
44 FALCON_CONSENSUS 38.33 33.57 22.71 49.86 45.23 41.77 21.50 18.69 -1.83 0.54 0.59 -0.92 0.74 1.02 -0.02 -1.29 -1.34 -3.69 38.33 33.57 22.71 49.86 45.23 41.77 21.50 18.69 24.85 0.18 0.19 -1.37 0.44 0.67 -0.38 -2.15 -2.14 -0.59 FALCON_CONSENSUS 44
45 FALCON 38.33 33.57 22.71 49.86 45.23 41.77 21.50 18.69 -1.83 0.54 0.59 -0.92 0.74 1.02 -0.02 -1.29 -1.34 -3.69 38.33 33.57 22.71 49.86 45.23 41.77 21.50 18.69 24.85 0.18 0.19 -1.37 0.44 0.67 -0.38 -2.15 -2.14 -0.59 FALCON 45
46 Zhou−SPARKS 37.98 33.86 31.29 45.83 37.04 39.02 32.24 29.91 27.34 0.49 0.63 0.04 0.31 0.09 -0.32 0.76 0.84 0.25 37.98 33.86 31.29 45.83 37.04 39.02 32.24 29.91 27.34 0.11 0.24 -0.31 -0.10 -0.42 -0.71 0.36 0.35 -0.17 Zhou−SPARKS 46
47 fais@hgc 37.89 32.09 41.54 48.19 43.19 54.09 26.64 22.27 30.99 0.48 0.37 1.18 0.56 0.79 1.33 -0.31 -0.65 0.74 42.51 36.21 46.55 55.69 46.62 59.56 37.38 36.14 34.05 0.95 0.67 1.57 1.21 0.86 1.75 1.56 1.73 0.96 fais@hgc 47
48 TJ_Jiang 37.80 30.84 36.04 48.06 38.52 44.39 27.10 21.18 30.05 0.47 0.18 0.56 0.55 0.26 0.27 -0.22 -0.86 0.62 38.07 34.17 38.81 49.72 45.28 49.88 27.10 25.00 32.68 0.13 0.30 0.62 0.42 0.68 0.59 -0.84 -0.74 0.73 TJ_Jiang 48
49 HHpred2 37.54 33.19 34.95 44.58 38.94 44.94 32.24 26.01 25.49 0.43 0.53 0.44 0.18 0.31 0.33 0.76 0.08 0.00 37.54 33.19 34.95 44.58 38.94 44.94 32.24 26.01 25.49 0.03 0.12 0.14 -0.27 -0.17 -0.00 0.36 -0.52 -0.48 HHpred2 49
50 PS2−server 37.11 31.88 30.10 50.83 43.98 44.84 18.93 17.84 14.31 0.37 0.34 -0.10 0.84 0.87 0.32 -1.78 -1.51 -1.51 38.94 34.35 35.42 50.83 43.98 45.98 32.94 30.92 27.62 0.29 0.33 0.20 0.56 0.51 0.12 0.52 0.57 -0.12 PS2−server 50
51 ABIpro 36.85 32.49 40.75 46.81 40.14 50.55 29.21 27.18 32.13 0.34 0.43 1.09 0.42 0.44 0.94 0.18 0.31 0.90 36.85 32.49 40.98 46.81 40.56 50.93 29.21 27.18 32.13 -0.09 -0.01 0.88 0.03 0.05 0.72 -0.35 -0.26 0.64 ABIpro 51
52 Frankenstein 35.63 30.46 29.36 46.25 38.84 41.35 21.73 20.64 19.08 0.17 0.13 -0.18 0.36 0.29 -0.07 -1.24 -0.96 -0.86 37.20 31.91 29.36 47.08 42.08 43.56 28.27 24.53 19.08 -0.03 -0.12 -0.55 0.07 0.25 -0.16 -0.57 -0.84 -1.56 Frankenstein 52
53 Bilab−UT 35.54 30.43 31.13 44.03 36.53 41.73 25.00 20.48 22.13 0.15 0.12 0.02 0.12 0.03 -0.03 -0.62 -0.99 -0.45 35.54 30.43 31.13 44.03 36.53 41.73 32.01 27.96 28.65 -0.33 -0.40 -0.33 -0.34 -0.49 -0.38 0.30 -0.08 0.05 Bilab−UT 53
54 BioSerf 34.15 28.28 33.97 43.75 36.81 42.09 30.61 23.75 27.92 -0.04 -0.20 0.33 0.09 0.06 0.01 0.45 -0.36 0.33 34.15 28.28 33.97 43.75 36.81 42.09 30.61 23.75 27.92 -0.59 -0.79 0.02 -0.38 -0.45 -0.34 -0.02 -1.02 -0.07 BioSerf 54
55 3Dpro 33.54 27.90 33.08 43.47 35.88 45.71 20.56 18.69 20.83 -0.12 -0.25 0.24 0.06 -0.04 0.41 -1.47 -1.34 -0.63 38.15 33.97 35.29 46.11 42.64 45.71 31.31 30.37 25.31 0.15 0.26 0.18 -0.06 0.33 0.09 0.14 0.45 -0.51 3Dpro 55
56 FOLDpro 33.54 27.90 33.08 43.47 35.88 45.71 20.56 18.69 20.83 -0.12 -0.25 0.24 0.06 -0.04 0.41 -1.47 -1.34 -0.63 38.15 33.97 34.16 46.11 42.64 45.71 31.31 30.37 26.40 0.15 0.26 0.04 -0.06 0.33 0.09 0.14 0.45 -0.33 FOLDpro 56
57 PRI−Yang−KiharA 33.54 27.79 27.89 44.17 36.39 40.64 20.79 17.84 15.59 -0.12 -0.27 -0.34 0.14 0.02 -0.15 -1.42 -1.51 -1.34 33.54 27.79 27.89 44.17 36.39 40.64 20.79 17.84 15.59 -0.70 -0.88 -0.73 -0.32 -0.51 -0.51 -2.32 -2.32 -2.15 PRI−Yang−KiharA 57
58 FAMSD 33.45 26.83 28.44 38.33 30.42 36.57 34.11 32.24 26.93 -0.13 -0.41 -0.28 -0.48 -0.66 -0.59 1.12 1.29 0.20 33.45 29.65 28.44 40.00 35.74 37.17 34.11 32.24 26.93 -0.72 -0.54 -0.67 -0.87 -0.59 -0.93 0.80 0.86 -0.24 FAMSD 58
59 FFASsuboptimal 33.36 30.72 24.77 37.36 28.24 32.26 35.51 33.96 23.93 -0.15 0.16 -0.69 -0.58 -0.90 -1.07 1.39 1.62 -0.21 33.36 30.72 26.70 37.64 28.61 35.26 35.51 33.96 25.31 -0.73 -0.34 -0.88 -1.19 -1.54 -1.16 1.12 1.24 -0.51 FFASsuboptimal 59
60 3DShot1 33.10 29.38 29.03 38.61 33.52 35.49 31.31 29.05 30.74 -0.18 -0.03 -0.21 -0.45 -0.31 -0.71 0.58 0.67 0.71 33.10 29.38 29.03 38.61 33.52 35.49 31.31 29.05 30.74 -0.78 -0.59 -0.59 -1.06 -0.89 -1.13 0.14 0.16 0.41 3DShot1 60
61 SHORTLE 33.10 27.24 18.69 49.86 42.45 45.42 11.68 11.68 -11.76 -0.18 -0.35 -1.36 0.74 0.70 0.38 -3.16 -2.70 -5.03 33.10 27.24 18.69 49.86 42.45 45.42 11.68 11.68 -11.76 -0.78 -0.99 -1.87 0.44 0.30 0.06 -4.45 -3.69 -6.76 SHORTLE 61
62 GS−MetaServer2 33.01 28.89 19.08 37.22 29.91 30.61 33.41 30.45 10.97 -0.20 -0.11 -1.32 -0.60 -0.71 -1.25 0.99 0.94 -1.96 33.01 28.89 19.08 37.50 31.20 30.61 33.41 30.45 10.97 -0.80 -0.68 -1.82 -1.21 -1.20 -1.71 0.63 0.47 -2.93 GS−MetaServer2 62
63 Hao_Kihara 33.01 28.02 26.24 37.22 29.44 35.53 34.81 33.88 22.42 -0.20 -0.23 -0.52 -0.60 -0.77 -0.71 1.25 1.61 -0.41 33.01 29.36 26.24 37.22 29.44 35.73 35.28 33.88 22.42 -0.80 -0.59 -0.94 -1.24 -1.43 -1.10 1.07 1.23 -1.00 Hao_Kihara 63
64 Zhang−Server 32.93 27.82 33.15 38.89 32.87 43.38 31.78 27.80 28.75 -0.21 -0.26 0.24 -0.42 -0.38 0.16 0.67 0.43 0.44 33.19 29.76 37.55 40.00 33.61 47.61 31.78 28.50 34.63 -0.76 -0.52 0.46 -0.87 -0.88 0.32 0.25 0.03 1.06 Zhang−Server 64
65 MULTICOM−CMFR 32.84 27.90 28.62 37.36 31.62 36.70 34.35 32.24 27.43 -0.22 -0.25 -0.26 -0.58 -0.52 -0.58 1.16 1.29 0.26 42.07 36.73 39.88 52.22 45.09 49.34 34.35 32.24 34.01 0.86 0.77 0.75 0.75 0.66 0.53 0.85 0.86 0.96 MULTICOM−CMFR 65
66 FFASstandard 32.75 28.92 25.10 37.08 27.64 35.24 33.65 33.02 19.59 -0.23 -0.10 -0.65 -0.61 -0.97 -0.74 1.03 1.44 -0.80 32.75 28.92 25.10 37.08 30.32 35.24 34.81 33.02 20.25 -0.85 -0.67 -1.08 -1.26 -1.32 -1.16 0.96 1.03 -1.36 FFASstandard 66
67 CBSU 32.67 28.14 29.22 38.61 29.49 37.16 30.84 30.22 28.10 -0.24 -0.22 -0.19 -0.45 -0.76 -0.53 0.49 0.90 0.35 33.36 28.51 29.47 38.89 33.24 38.11 31.78 30.68 28.10 -0.73 -0.75 -0.54 -1.02 -0.93 -0.82 0.25 0.52 -0.04 CBSU 67
68 LOOPP_Server 32.40 24.91 13.89 44.86 34.95 31.66 15.19 14.10 -3.51 -0.28 -0.69 -1.90 0.21 -0.15 -1.13 -2.49 -2.23 -3.91 36.50 32.14 25.92 46.53 40.69 42.64 28.97 23.60 6.17 -0.16 -0.08 -0.98 -0.01 0.07 -0.27 -0.41 -1.05 -3.74 LOOPP_Server 68
69 GS−KudlatyPred 32.14 29.01 22.09 37.22 32.50 32.65 32.24 31.46 16.15 -0.32 -0.09 -0.98 -0.60 -0.42 -1.03 0.76 1.14 -1.26 32.14 29.01 22.09 37.22 32.50 32.65 32.24 31.46 16.15 -0.96 -0.66 -1.45 -1.24 -1.02 -1.47 0.36 0.69 -2.06 GS−KudlatyPred 69
70 AMU−Biology 32.14 25.87 30.23 37.92 30.69 37.74 31.78 29.44 31.30 -0.32 -0.55 -0.08 -0.52 -0.63 -0.47 0.67 0.75 0.79 32.14 25.87 30.23 37.92 30.69 37.74 31.78 29.44 31.30 -0.96 -1.24 -0.44 -1.15 -1.27 -0.86 0.25 0.24 0.50 AMU−Biology 70
71 MULTICOM−CLUSTER 32.06 27.58 30.38 38.19 31.07 37.08 30.84 29.13 31.67 -0.33 -0.30 -0.06 -0.50 -0.58 -0.54 0.49 0.69 0.84 41.64 37.28 37.91 51.39 43.89 49.78 34.35 30.61 31.67 0.79 0.87 0.50 0.64 0.50 0.58 0.85 0.50 0.56 MULTICOM−CLUSTER 71
72 TASSER 31.97 26.63 32.37 38.19 31.07 42.52 31.54 24.38 27.98 -0.34 -0.44 0.16 -0.50 -0.58 0.06 0.63 -0.24 0.34 37.89 32.09 41.75 48.19 43.19 54.09 33.41 30.61 32.29 0.10 -0.09 0.98 0.21 0.40 1.09 0.63 0.50 0.67 TASSER 72
73 PSI 31.97 26.28 22.20 43.33 34.91 28.07 17.99 14.25 24.85 -0.34 -0.49 -0.97 0.05 -0.15 -1.53 -1.96 -2.20 -0.08 38.33 33.57 30.32 49.86 45.23 41.77 21.50 18.69 25.96 0.18 0.19 -0.43 0.44 0.67 -0.38 -2.15 -2.14 -0.40 PSI 73
74 EB_AMU_Physics 31.88 27.12 34.90 35.97 30.69 41.16 32.94 31.07 37.83 -0.35 -0.37 0.44 -0.73 -0.63 -0.09 0.90 1.06 1.67 31.88 27.12 34.90 35.97 30.69 41.16 32.94 31.07 37.83 -1.00 -1.01 0.13 -1.41 -1.27 -0.45 0.52 0.60 1.60 EB_AMU_Physics 74
75 mufold 31.79 27.73 30.19 38.47 31.43 36.68 30.84 29.28 31.86 -0.37 -0.28 -0.09 -0.47 -0.54 -0.58 0.49 0.71 0.86 42.16 37.80 40.24 52.64 45.05 49.08 32.71 30.53 33.73 0.88 0.97 0.79 0.80 0.65 0.49 0.47 0.48 0.91 mufold 75
76 Chicken_George 31.79 26.45 35.52 46.81 36.62 48.04 20.09 19.63 30.49 -0.37 -0.47 0.51 0.42 0.04 0.67 -1.56 -1.16 0.68 34.93 28.72 37.09 50.00 42.22 50.47 22.90 22.74 30.57 -0.45 -0.71 0.40 0.45 0.27 0.66 -1.82 -1.24 0.38 Chicken_George 76
77 MUSTER 31.71 27.12 30.33 36.81 31.25 39.05 31.31 28.19 28.06 -0.38 -0.37 -0.07 -0.64 -0.56 -0.32 0.58 0.50 0.35 31.71 28.40 30.33 37.78 32.41 39.05 32.71 31.93 28.48 -1.04 -0.77 -0.43 -1.17 -1.04 -0.70 0.47 0.79 0.02 MUSTER 77
78 Jiang_Zhu 31.62 28.16 34.48 42.92 37.78 45.64 20.79 16.59 28.27 -0.39 -0.21 0.39 0.00 0.17 0.40 -1.42 -1.75 0.38 31.62 28.16 34.48 42.92 37.78 45.64 20.79 16.59 28.27 -1.05 -0.82 0.08 -0.49 -0.32 0.08 -2.32 -2.60 -0.01 Jiang_Zhu 78
79 LevittGroup 31.62 26.63 29.51 36.81 28.10 36.03 32.48 26.25 31.79 -0.39 -0.44 -0.16 -0.64 -0.92 -0.65 0.81 0.13 0.85 31.62 26.63 29.51 36.81 28.10 36.03 32.48 26.25 31.79 -1.05 -1.10 -0.53 -1.30 -1.61 -1.06 0.41 -0.46 0.58 LevittGroup 79
80 Fiser−M4T 31.45 28.66 15.83 38.33 33.61 29.99 29.44 28.50 3.32 -0.41 -0.14 -1.68 -0.48 -0.30 -1.32 0.23 0.56 -2.99 31.45 28.66 15.83 38.33 33.61 29.99 29.44 28.50 3.32 -1.08 -0.72 -2.23 -1.10 -0.88 -1.79 -0.30 0.03 -4.22 Fiser−M4T 80
81 Softberry 31.27 27.44 31.43 36.81 29.07 41.35 28.27 27.02 27.83 -0.44 -0.32 0.05 -0.64 -0.81 -0.07 0.00 0.28 0.32 31.27 27.44 31.43 36.81 29.07 41.35 28.27 27.02 27.83 -1.12 -0.95 -0.30 -1.30 -1.48 -0.43 -0.57 -0.29 -0.09 Softberry 81
82 MULTICOM−RANK 31.27 26.74 27.89 37.50 31.20 35.73 31.78 28.82 26.95 -0.44 -0.42 -0.34 -0.57 -0.57 -0.69 0.67 0.63 0.20 41.81 34.84 40.37 51.25 43.01 49.24 32.94 30.53 33.56 0.82 0.42 0.81 0.62 0.38 0.51 0.52 0.48 0.88 MULTICOM−RANK 82
83 A−TASSER 31.18 27.82 30.86 35.97 29.21 39.55 30.84 27.41 29.55 -0.45 -0.26 -0.01 -0.73 -0.79 -0.27 0.49 0.35 0.55 39.63 34.47 41.75 50.69 43.56 52.46 30.84 28.43 32.29 0.42 0.35 0.98 0.55 0.45 0.90 0.03 0.02 0.67 A−TASSER 83
84 nFOLD3 31.18 25.46 23.92 37.08 33.38 34.35 25.47 20.79 19.51 -0.45 -0.61 -0.78 -0.61 -0.32 -0.84 -0.53 -0.93 -0.81 36.76 31.30 31.89 43.33 35.93 39.41 31.54 31.31 28.11 -0.11 -0.23 -0.24 -0.43 -0.57 -0.66 0.19 0.66 -0.04 nFOLD3 84
85 pro−sp3−TASSER 31.01 25.38 31.49 36.25 28.75 40.79 31.31 28.66 28.86 -0.47 -0.62 0.06 -0.70 -0.85 -0.13 0.58 0.59 0.46 39.46 32.84 42.90 50.56 43.19 54.23 31.31 28.66 34.27 0.39 0.05 1.12 0.53 0.40 1.11 0.14 0.07 1.00 pro−sp3−TASSER 85
86 FFASflextemplate 30.75 24.65 13.26 39.58 34.31 32.17 17.52 17.21 -8.14 -0.51 -0.73 -1.97 -0.35 -0.22 -1.08 -2.05 -1.63 -4.54 30.75 24.65 13.26 39.58 34.31 32.17 17.52 17.21 -8.14 -1.21 -1.46 -2.54 -0.93 -0.78 -1.53 -3.08 -2.46 -6.15 FFASflextemplate 86
87 SAM−T06−server 30.66 25.23 34.17 34.03 25.79 39.31 32.94 30.61 38.43 -0.52 -0.65 0.36 -0.94 -1.18 -0.29 0.90 0.97 1.75 38.50 31.59 34.17 52.64 45.05 39.31 32.94 31.46 38.43 0.21 -0.18 0.04 0.80 0.65 -0.67 0.52 0.69 1.70 SAM−T06−server 87
88 SAM−T02−server 30.40 25.99 18.69 34.72 27.73 28.78 31.78 29.28 12.65 -0.56 -0.53 -1.36 -0.86 -0.96 -1.45 0.67 0.71 -1.73 30.40 25.99 18.69 35.00 29.44 30.42 32.24 31.46 12.65 -1.28 -1.22 -1.87 -1.54 -1.43 -1.73 0.36 0.69 -2.65 SAM−T02−server 88
89 panther_server 30.23 24.83 13.72 36.53 30.88 29.28 23.60 22.20 -0.36 -0.58 -0.70 -1.91 -0.67 -0.61 -1.40 -0.89 -0.66 -3.49 30.92 27.09 20.90 37.78 32.04 31.85 32.01 31.23 14.87 -1.18 -1.01 -1.60 -1.17 -1.09 -1.56 0.30 0.64 -2.27 panther_server 89
90 Pcons_dot_net 29.88 25.87 16.54 37.22 32.50 34.60 21.73 20.02 -2.01 -0.63 -0.55 -1.60 -0.60 -0.42 -0.81 -1.24 -1.08 -3.71 40.77 36.15 26.41 52.78 46.39 45.39 32.94 31.23 11.10 0.63 0.66 -0.92 0.82 0.83 0.05 0.52 0.64 -2.91 Pcons_dot_net 90
91 Pcons_multi 29.88 25.87 16.54 37.22 32.50 34.60 21.73 20.02 -2.01 -0.63 -0.55 -1.60 -0.60 -0.42 -0.81 -1.24 -1.08 -3.71 35.45 28.43 28.82 45.28 33.70 39.82 26.87 20.02 22.16 -0.35 -0.77 -0.62 -0.17 -0.86 -0.61 -0.90 -1.84 -1.04 Pcons_multi 91
92 3D−JIGSAW_AEP 29.88 25.81 22.45 34.17 31.30 33.52 30.14 29.21 16.95 -0.63 -0.56 -0.94 -0.92 -0.56 -0.93 0.36 0.70 -1.15 30.14 26.74 22.45 34.44 31.48 33.58 30.37 29.91 16.95 -1.32 -1.08 -1.41 -1.61 -1.16 -1.36 -0.08 0.35 -1.92 3D−JIGSAW_AEP 92
93 3D−JIGSAW_V3 29.62 24.86 17.54 33.89 28.15 27.29 28.74 27.65 13.91 -0.67 -0.70 -1.49 -0.95 -0.91 -1.62 0.09 0.40 -1.56 30.05 26.60 17.54 33.89 28.66 27.29 30.37 29.75 15.83 -1.34 -1.10 -2.01 -1.69 -1.54 -2.11 -0.08 0.31 -2.11 3D−JIGSAW_V3 93
94 keasar 29.36 25.81 33.45 34.86 30.60 42.77 28.50 27.41 31.53 -0.70 -0.56 0.28 -0.85 -0.64 0.09 0.05 0.35 0.82 36.85 30.92 37.68 47.78 40.65 46.36 28.50 27.41 35.20 -0.09 -0.30 0.48 0.16 0.06 0.17 -0.52 -0.21 1.16 keasar 94
95 GeneSilicoMetaServer 29.01 24.83 15.95 36.67 32.04 33.60 21.73 19.86 -2.02 -0.75 -0.70 -1.67 -0.66 -0.47 -0.92 -1.24 -1.11 -3.71 32.14 27.15 21.40 37.36 32.04 33.60 31.54 27.49 13.80 -0.96 -1.00 -1.54 -1.22 -1.09 -1.35 0.19 -0.19 -2.45 GeneSilicoMetaServer 95
96 ACOMPMOD 28.57 25.20 16.26 35.69 32.73 34.33 21.26 19.39 -2.26 -0.81 -0.65 -1.63 -0.76 -0.40 -0.84 -1.33 -1.21 -3.75 28.57 25.20 16.26 35.69 32.73 34.33 21.26 19.39 23.50 -1.61 -1.36 -2.17 -1.45 -0.99 -1.27 -2.21 -1.98 -0.82 ACOMPMOD 96
97 FUGUE_KM 28.57 23.52 14.41 36.11 31.11 31.01 21.50 18.69 -1.83 -0.81 -0.90 -1.84 -0.72 -0.58 -1.21 -1.29 -1.34 -3.69 28.57 23.52 16.98 36.11 31.11 31.01 21.50 20.33 25.62 -1.61 -1.67 -2.08 -1.39 -1.21 -1.66 -2.15 -1.77 -0.46 FUGUE_KM 97
98 Distill 28.57 23.23 17.31 32.78 26.67 27.10 28.74 26.09 14.59 -0.81 -0.94 -1.52 -1.07 -1.08 -1.64 0.09 0.10 -1.47 28.57 23.23 22.38 32.78 26.67 31.76 28.74 26.09 21.58 -1.61 -1.73 -1.42 -1.83 -1.80 -1.57 -0.46 -0.50 -1.14 Distill 98
99 SMEG−CCP 28.48 20.47 29.12 36.39 25.69 36.58 25.23 21.03 26.59 -0.82 -1.35 -0.20 -0.69 -1.19 -0.59 -0.58 -0.89 0.15 28.48 20.47 29.12 36.39 25.69 36.58 25.23 21.03 26.59 -1.63 -2.24 -0.58 -1.35 -1.93 -1.00 -1.28 -1.62 -0.29 SMEG−CCP 99
100 rehtnap 28.22 23.61 12.77 32.78 27.78 23.23 25.93 23.13 6.99 -0.86 -0.88 -2.02 -1.07 -0.96 -2.06 -0.44 -0.48 -2.50 29.27 23.95 12.77 34.58 27.78 23.23 25.93 23.13 6.99 -1.48 -1.59 -2.60 -1.59 -1.65 -2.59 -1.12 -1.15 -3.60 rehtnap 100
101 fleil 28.14 23.43 23.98 33.61 27.13 31.69 24.77 23.68 24.15 -0.87 -0.91 -0.77 -0.98 -1.03 -1.13 -0.66 -0.37 -0.18 31.97 28.43 29.18 37.08 32.18 35.00 32.24 29.13 33.42 -0.99 -0.77 -0.57 -1.26 -1.07 -1.19 0.36 0.17 0.86 fleil 101
102 xianmingpan 28.05 24.68 17.97 34.31 29.40 29.90 28.04 26.95 9.42 -0.88 -0.73 -1.44 -0.91 -0.77 -1.33 -0.04 0.26 -2.17 28.05 24.68 17.97 34.31 29.40 29.90 28.04 26.95 9.42 -1.71 -1.46 -1.96 -1.63 -1.44 -1.80 -0.62 -0.31 -3.19 xianmingpan 102
103 fais−server 26.31 20.96 20.25 26.94 21.02 24.49 32.24 30.06 29.29 -1.12 -1.28 -1.19 -1.69 -1.72 -1.92 0.76 0.87 0.51 39.90 34.55 32.39 47.92 43.10 41.18 32.94 30.76 29.29 0.47 0.37 -0.18 0.18 0.39 -0.45 0.52 0.53 0.16 fais−server 103
104 StruPPi 26.05 21.34 21.88 32.08 24.95 31.37 24.77 23.83 20.37 -1.16 -1.22 -1.01 -1.14 -1.28 -1.17 -0.66 -0.34 -0.69 26.05 21.34 21.88 32.08 24.95 31.37 24.77 23.83 20.37 -2.07 -2.08 -1.48 -1.93 -2.03 -1.62 -1.39 -1.00 -1.34 StruPPi 104
105 taylor 23.95 18.38 16.69 30.00 25.65 31.09 19.63 16.67 4.89 -1.45 -1.66 -1.58 -1.36 -1.20 -1.20 -1.64 -1.73 -2.78 26.13 18.76 19.79 31.39 25.65 36.36 21.73 16.67 5.28 -2.06 -2.55 -1.74 -2.02 -1.94 -1.02 -2.10 -2.58 -3.89 taylor 105
106 Pushchino 22.56 18.79 3.79 21.39 16.20 5.68 31.54 29.05 15.06 -1.64 -1.60 -3.02 -2.27 -2.26 -3.99 0.63 0.67 -1.41 22.56 18.79 3.79 21.39 16.20 5.68 31.54 29.05 15.06 -2.71 -2.55 -3.71 -3.35 -3.20 -4.69 0.19 0.16 -2.24 Pushchino 106
107 ProtAnG 20.82 17.57 27.36 31.67 26.48 36.11 28.50 24.30 27.29 -1.89 -1.78 -0.40 -1.19 -1.10 -0.64 0.05 -0.25 0.24 20.82 17.57 27.36 31.67 26.48 36.11 28.50 24.30 27.29 -3.03 -2.77 -0.80 -1.98 -1.83 -1.05 -0.52 -0.89 -0.18 ProtAnG 107
108 Sasaki−Cetin−Sasai 20.30 18.09 32.81 30.14 25.23 46.08 17.99 16.12 26.74 -1.96 -1.70 0.21 -1.35 -1.24 0.45 -1.96 -1.84 0.17 20.30 18.09 32.81 30.14 25.23 46.08 18.93 17.60 27.02 -3.13 -2.68 -0.13 -2.18 -1.99 0.14 -2.75 -2.38 -0.22 Sasaki−Cetin−Sasai 108
109 JIVE08 16.46 13.10 20.03 18.47 16.90 25.36 26.40 22.82 27.20 -2.49 -2.44 -1.21 -2.58 -2.18 -1.83 -0.35 -0.54 0.23 42.16 37.57 44.54 52.78 47.31 56.55 32.24 27.57 32.98 0.88 0.93 1.32 0.82 0.95 1.39 0.36 -0.17 0.78 JIVE08 109
110 SAINT1 14.46 10.22 23.11 22.64 15.88 34.98 18.46 15.03 19.66 -2.77 -2.86 -0.87 -2.14 -2.30 -0.77 -1.87 -2.05 -0.79 14.46 10.22 23.11 22.64 15.88 34.98 18.46 15.03 19.66 -4.20 -4.13 -1.33 -3.18 -3.24 -1.19 -2.86 -2.95 -1.46 SAINT1 110
111 Kolinski 12.72 11.47 29.82 14.72 12.08 39.74 17.06 14.33 25.65 -3.01 -2.68 -0.13 -2.98 -2.73 -0.25 -2.13 -2.19 0.02 33.62 28.40 33.45 37.50 31.02 40.81 35.75 30.30 33.52 -0.69 -0.77 -0.05 -1.21 -1.22 -0.49 1.18 0.43 0.87 Kolinski 111
112 MeilerLabRene 12.63 10.02 22.05 18.33 15.14 29.41 17.06 15.50 25.82 -3.02 -2.89 -0.99 -2.60 -2.38 -1.38 -2.13 -1.96 0.05 13.50 11.82 23.98 19.31 15.97 29.41 19.16 17.13 33.27 -4.38 -3.84 -1.22 -3.62 -3.23 -1.85 -2.70 -2.48 0.83 MeilerLabRene 112
113 RBO−Proteus 12.11 11.47 20.99 17.36 16.34 29.67 23.13 17.84 23.94 -3.09 -2.68 -1.11 -2.70 -2.25 -1.35 -0.98 -1.51 -0.21 12.11 11.47 21.94 18.33 17.22 30.41 23.13 17.84 26.54 -4.63 -3.90 -1.47 -3.75 -3.06 -1.74 -1.77 -2.32 -0.30 RBO−Proteus 113
114 Scheraga 11.85 10.19 22.24 18.06 15.32 28.84 18.22 15.81 27.25 -3.13 -2.87 -0.97 -2.63 -2.36 -1.44 -1.91 -1.90 0.24 11.85 10.19 22.24 18.06 15.32 28.84 18.22 15.81 27.25 -4.68 -4.14 -1.43 -3.79 -3.32 -1.92 -2.92 -2.77 -0.18 Scheraga 114
115 forecast 11.59 9.58 14.86 19.44 15.83 21.94 15.89 13.24 19.35 -3.17 -2.96 -1.79 -2.48 -2.31 -2.20 -2.36 -2.40 -0.83 28.92 24.22 23.58 35.28 30.18 34.32 21.73 20.64 22.65 -1.55 -1.54 -1.27 -1.50 -1.33 -1.27 -2.10 -1.70 -0.96 forecast 115
116 MUFOLD−MD 10.98 10.31 22.03 15.56 14.81 27.20 19.63 17.13 30.06 -3.25 -2.85 -0.99 -2.89 -2.42 -1.63 -1.64 -1.65 0.62 11.59 10.31 26.70 17.78 15.14 32.97 20.56 19.32 33.94 -4.73 -4.12 -0.88 -3.82 -3.34 -1.43 -2.37 -2.00 0.94 MUFOLD−MD 116
117 DistillSN 10.98 9.41 0.94 14.17 12.78 1.68 14.95 12.62 13.64 -3.25 -2.98 -3.33 -3.04 -2.65 -4.43 -2.54 -2.52 -1.60 13.33 11.12 9.25 16.67 12.78 12.90 16.36 13.63 18.03 -4.41 -3.97 -3.04 -3.97 -3.66 -3.83 -3.35 -3.26 -1.74 DistillSN 117
118 DelCLab 9.67 9.06 19.87 15.28 14.31 24.91 16.12 13.47 28.30 -3.43 -3.03 -1.23 -2.92 -2.48 -1.88 -2.31 -2.36 0.38 10.11 9.06 19.87 15.28 14.31 24.91 18.93 16.12 28.34 -5.00 -4.35 -1.73 -4.16 -3.45 -2.39 -2.75 -2.70 0.00 DelCLab 118
119 RANDOM 9.31 8.02 9.31 14.85 12.81 14.85 18.69 15.98 18.69 -3.48 -3.19 -2.40 -2.97 -2.65 -2.98 -1.82 -1.87 -0.92 9.31 8.02 9.31 14.85 12.81 14.85 18.69 15.98 18.69 -5.15 -4.54 -3.03 -4.21 -3.65 -3.59 -2.81 -2.74 -1.63 RANDOM 119
120 POEMQA 9.23 8.71 14.29 14.72 11.76 19.21 16.82 13.79 23.05 -3.49 -3.08 -1.85 -2.98 -2.77 -2.50 -2.18 -2.29 -0.33 43.29 38.99 40.54 54.58 50.69 51.37 32.24 31.78 32.41 1.09 1.19 0.83 1.06 1.40 0.77 0.36 0.76 0.69 POEMQA 120
121 POEM 9.23 8.71 14.29 14.72 11.76 19.21 16.82 13.79 23.05 -3.49 -3.08 -1.85 -2.98 -2.77 -2.50 -2.18 -2.29 -0.33 43.29 38.99 40.54 54.58 50.69 51.37 32.24 31.78 32.41 1.09 1.19 0.83 1.06 1.40 0.77 0.36 0.76 0.69 POEM 121
122 MUFOLD−Server 9.15 7.70 11.57 14.31 11.62 16.08 17.06 15.11 20.60 -3.50 -3.23 -2.15 -3.02 -2.78 -2.85 -2.13 -2.04 -0.66 9.15 7.93 15.70 14.44 12.22 22.18 17.06 15.11 20.97 -5.17 -4.56 -2.24 -4.27 -3.73 -2.72 -3.19 -2.93 -1.24 MUFOLD−Server 122
123 mariner1 9.06 7.75 12.62 14.03 11.94 16.07 15.89 15.42 21.38 -3.52 -3.23 -2.04 -3.05 -2.75 -2.85 -2.36 -1.98 -0.55 37.46 30.95 33.14 50.00 42.87 44.19 19.86 18.93 25.53 0.02 -0.30 -0.09 0.45 0.36 -0.09 -2.54 -2.08 -0.47 mariner1 123
124 TWPPLAB 8.88 8.42 13.91 14.31 13.47 17.27 16.59 16.59 24.02 -3.54 -3.13 -1.89 -3.02 -2.57 -2.72 -2.22 -1.75 -0.20 8.88 8.42 13.91 14.31 13.47 17.27 16.59 16.59 24.02 -5.22 -4.47 -2.46 -4.29 -3.56 -3.30 -3.30 -2.60 -0.73 TWPPLAB 124
125 psiphifoldings 7.93 5.63 9.71 11.81 8.15 12.27 15.19 13.01 21.17 -3.67 -3.54 -2.36 -3.29 -3.17 -3.27 -2.49 -2.45 -0.58 7.93 5.63 9.71 11.81 8.15 12.27 15.19 13.01 21.17 -5.40 -4.98 -2.98 -4.62 -4.27 -3.90 -3.63 -3.39 -1.21 psiphifoldings 125
126 mahmood−torda−server 7.67 6.79 11.36 12.08 9.58 17.06 15.42 12.62 18.20 -3.71 -3.37 -2.18 -3.26 -3.01 -2.74 -2.45 -2.52 -0.98 7.67 6.79 12.54 12.08 9.58 18.05 17.52 16.12 27.12 -5.45 -4.77 -2.63 -4.58 -4.08 -3.21 -3.08 -2.70 -0.21 mahmood−torda−server 126
127 schenk−torda−server 7.40 6.50 7.37 11.25 9.86 11.06 14.95 14.41 16.92 -3.75 -3.41 -2.62 -3.35 -2.98 -3.40 -2.54 -2.17 -1.16 9.41 8.88 7.88 15.14 12.64 11.06 19.86 16.28 20.45 -5.13 -4.38 -3.21 -4.18 -3.67 -4.05 -2.54 -2.67 -1.33 schenk−torda−server 127
128 Abagyan                                                       -3.48 -3.19 -2.40 -2.97 -2.65 -2.98 -1.82 -1.87 -0.92                                                       -5.15 -4.54 -3.03 -4.21 -3.65 -3.59 -2.81 -2.74 -1.63 Abagyan 128
129 BHAGEERATH                                                       -3.48 -3.19 -2.40 -2.97 -2.65 -2.98 -1.82 -1.87 -0.92                                                       -5.15 -4.54 -3.03 -4.21 -3.65 -3.59 -2.81 -2.74 -1.63 BHAGEERATH 129
130 FEIG_REFINE                                                       -3.48 -3.19 -2.40 -2.97 -2.65 -2.98 -1.82 -1.87 -0.92                                                       -5.15 -4.54 -3.03 -4.21 -3.65 -3.59 -2.81 -2.74 -1.63 FEIG_REFINE 130
131 FLOUDAS                                                       -3.48 -3.19 -2.40 -2.97 -2.65 -2.98 -1.82 -1.87 -0.92                                                       -5.15 -4.54 -3.03 -4.21 -3.65 -3.59 -2.81 -2.74 -1.63 FLOUDAS 131
132 FrankensteinLong                                                       -3.48 -3.19 -2.40 -2.97 -2.65 -2.98 -1.82 -1.87 -0.92                                                       -5.15 -4.54 -3.03 -4.21 -3.65 -3.59 -2.81 -2.74 -1.63 FrankensteinLong 132
133 HCA                                                       -3.48 -3.19 -2.40 -2.97 -2.65 -2.98 -1.82 -1.87 -0.92                                                       -5.15 -4.54 -3.03 -4.21 -3.65 -3.59 -2.81 -2.74 -1.63 HCA 133
134 Handl−Lovell                                                       -3.48 -3.19 -2.40 -2.97 -2.65 -2.98 -1.82 -1.87 -0.92                                                       -5.15 -4.54 -3.03 -4.21 -3.65 -3.59 -2.81 -2.74 -1.63 Handl−Lovell 134
135 KudlatyPredHuman                                                       -3.48 -3.19 -2.40 -2.97 -2.65 -2.98 -1.82 -1.87 -0.92                                                       -5.15 -4.54 -3.03 -4.21 -3.65 -3.59 -2.81 -2.74 -1.63 KudlatyPredHuman 135
136 Linnolt−UH−CMB                                                       -3.48 -3.19 -2.40 -2.97 -2.65 -2.98 -1.82 -1.87 -0.92                                                       -5.15 -4.54 -3.03 -4.21 -3.65 -3.59 -2.81 -2.74 -1.63 Linnolt−UH−CMB 136
137 NIM2                                                       -3.48 -3.19 -2.40 -2.97 -2.65 -2.98 -1.82 -1.87 -0.92                                                       -5.15 -4.54 -3.03 -4.21 -3.65 -3.59 -2.81 -2.74 -1.63 NIM2 137
138 Nano_team                                                       -3.48 -3.19 -2.40 -2.97 -2.65 -2.98 -1.82 -1.87 -0.92                                                       -5.15 -4.54 -3.03 -4.21 -3.65 -3.59 -2.81 -2.74 -1.63 Nano_team 138
139 NirBenTal                                                       -3.48 -3.19 -2.40 -2.97 -2.65 -2.98 -1.82 -1.87 -0.92                                                       -5.15 -4.54 -3.03 -4.21 -3.65 -3.59 -2.81 -2.74 -1.63 NirBenTal 139
140 OLGAFS                                                       -3.48 -3.19 -2.40 -2.97 -2.65 -2.98 -1.82 -1.87 -0.92                                                       -5.15 -4.54 -3.03 -4.21 -3.65 -3.59 -2.81 -2.74 -1.63 OLGAFS 140
141 Ozkan−Shell                                                       -3.48 -3.19 -2.40 -2.97 -2.65 -2.98 -1.82 -1.87 -0.92                                                       -5.15 -4.54 -3.03 -4.21 -3.65 -3.59 -2.81 -2.74 -1.63 Ozkan−Shell 141
142 PHAISTOS                                                       -3.48 -3.19 -2.40 -2.97 -2.65 -2.98 -1.82 -1.87 -0.92                                                       -5.15 -4.54 -3.03 -4.21 -3.65 -3.59 -2.81 -2.74 -1.63 PHAISTOS 142
143 POISE                                                       -3.48 -3.19 -2.40 -2.97 -2.65 -2.98 -1.82 -1.87 -0.92                                                       -5.15 -4.54 -3.03 -4.21 -3.65 -3.59 -2.81 -2.74 -1.63 POISE 143
144 PZ−UAM                                                       -3.48 -3.19 -2.40 -2.97 -2.65 -2.98 -1.82 -1.87 -0.92                                                       -5.15 -4.54 -3.03 -4.21 -3.65 -3.59 -2.81 -2.74 -1.63 PZ−UAM 144
145 ProteinShop                                                       -3.48 -3.19 -2.40 -2.97 -2.65 -2.98 -1.82 -1.87 -0.92                                                       -5.15 -4.54 -3.03 -4.21 -3.65 -3.59 -2.81 -2.74 -1.63 ProteinShop 145
146 RPFM                                                       -3.48 -3.19 -2.40 -2.97 -2.65 -2.98 -1.82 -1.87 -0.92                                                       -5.15 -4.54 -3.03 -4.21 -3.65 -3.59 -2.81 -2.74 -1.63 RPFM 146
147 ShakAbInitio                                                       -3.48 -3.19 -2.40 -2.97 -2.65 -2.98 -1.82 -1.87 -0.92                                                       -5.15 -4.54 -3.03 -4.21 -3.65 -3.59 -2.81 -2.74 -1.63 ShakAbInitio 147
148 TsaiLab                                                       -3.48 -3.19 -2.40 -2.97 -2.65 -2.98 -1.82 -1.87 -0.92                                                       -5.15 -4.54 -3.03 -4.21 -3.65 -3.59 -2.81 -2.74 -1.63 TsaiLab 148
149 UCDavisGenome                                                       -3.48 -3.19 -2.40 -2.97 -2.65 -2.98 -1.82 -1.87 -0.92                                                       -5.15 -4.54 -3.03 -4.21 -3.65 -3.59 -2.81 -2.74 -1.63 UCDavisGenome 149
150 Wolfson−FOBIA                                                       -3.48 -3.19 -2.40 -2.97 -2.65 -2.98 -1.82 -1.87 -0.92                                                       -5.15 -4.54 -3.03 -4.21 -3.65 -3.59 -2.81 -2.74 -1.63 Wolfson−FOBIA 150
151 Wolynes                                                       -3.48 -3.19 -2.40 -2.97 -2.65 -2.98 -1.82 -1.87 -0.92                                                       -5.15 -4.54 -3.03 -4.21 -3.65 -3.59 -2.81 -2.74 -1.63 Wolynes 151
152 YASARA                                                       -3.48 -3.19 -2.40 -2.97 -2.65 -2.98 -1.82 -1.87 -0.92                                                       -5.15 -4.54 -3.03 -4.21 -3.65 -3.59 -2.81 -2.74 -1.63 YASARA 152
153 YASARARefine                                                       -3.48 -3.19 -2.40 -2.97 -2.65 -2.98 -1.82 -1.87 -0.92                                                       -5.15 -4.54 -3.03 -4.21 -3.65 -3.59 -2.81 -2.74 -1.63 YASARARefine 153
154 dill_ucsf                                                       -3.48 -3.19 -2.40 -2.97 -2.65 -2.98 -1.82 -1.87 -0.92                                                       -5.15 -4.54 -3.03 -4.21 -3.65 -3.59 -2.81 -2.74 -1.63 dill_ucsf 154
155 dill_ucsf_extended                                                       -3.48 -3.19 -2.40 -2.97 -2.65 -2.98 -1.82 -1.87 -0.92                                                       -5.15 -4.54 -3.03 -4.21 -3.65 -3.59 -2.81 -2.74 -1.63 dill_ucsf_extended 155
156 huber−torda−server                                                       -3.48 -3.19 -2.40 -2.97 -2.65 -2.98 -1.82 -1.87 -0.92                                                       -5.15 -4.54 -3.03 -4.21 -3.65 -3.59 -2.81 -2.74 -1.63 huber−torda−server 156
157 igor                                                       -3.48 -3.19 -2.40 -2.97 -2.65 -2.98 -1.82 -1.87 -0.92                                                       -5.15 -4.54 -3.03 -4.21 -3.65 -3.59 -2.81 -2.74 -1.63 igor 157
158 jacobson                                                       -3.48 -3.19 -2.40 -2.97 -2.65 -2.98 -1.82 -1.87 -0.92                                                       -5.15 -4.54 -3.03 -4.21 -3.65 -3.59 -2.81 -2.74 -1.63 jacobson 158
159 keasar−server                                                       -3.48 -3.19 -2.40 -2.97 -2.65 -2.98 -1.82 -1.87 -0.92                                                       0.39 0.67 -3.03 0.16 -0.12 -3.59 1.07 0.95 -1.63 keasar−server 159
160 mti                                                       -3.48 -3.19 -2.40 -2.97 -2.65 -2.98 -1.82 -1.87 -0.92                                                       -5.15 -4.54 -3.03 -4.21 -3.65 -3.59 -2.81 -2.74 -1.63 mti 160
161 mumssp                                                       -3.48 -3.19 -2.40 -2.97 -2.65 -2.98 -1.82 -1.87 -0.92                                                       -5.15 -4.54 -3.03 -4.21 -3.65 -3.59 -2.81 -2.74 -1.63 mumssp 161
162 ricardo                                                       -3.48 -3.19 -2.40 -2.97 -2.65 -2.98 -1.82 -1.87 -0.92                                                       -5.15 -4.54 -3.03 -4.21 -3.65 -3.59 -2.81 -2.74 -1.63 ricardo 162
163 rivilo                                                       -3.48 -3.19 -2.40 -2.97 -2.65 -2.98 -1.82 -1.87 -0.92                                                       -5.15 -4.54 -3.03 -4.21 -3.65 -3.59 -2.81 -2.74 -1.63 rivilo 163
164 sessions                                                       -3.48 -3.19 -2.40 -2.97 -2.65 -2.98 -1.82 -1.87 -0.92                                                       -5.15 -4.54 -3.03 -4.21 -3.65 -3.59 -2.81 -2.74 -1.63 sessions 164
165 test_http_server_01                                                       -3.48 -3.19 -2.40 -2.97 -2.65 -2.98 -1.82 -1.87 -0.92                                                       -5.15 -4.54 -3.03 -4.21 -3.65 -3.59 -2.81 -2.74 -1.63 test_http_server_01 165
166 tripos_08                                                       -3.48 -3.19 -2.40 -2.97 -2.65 -2.98 -1.82 -1.87 -0.92                                                       -5.15 -4.54 -3.03 -4.21 -3.65 -3.59 -2.81 -2.74 -1.63 tripos_08 166