T0445

X-ray Targets
387 388 389 390
391 392 393 394
395 396 397 398
399 400 401 402
403 404 405 406
407 408 409 410
411 412 413 414
415 416 417 418
419 420 421 422
423 424 425 426
427 428 429 430
431 432 433 434
435 436 438 439
440 441 442 443
444 445 446 447
448 449 450 451
452 453 454 455
456 457 458 459
461 463 465 470
477 478 479 481
483 485 486 487
488 489 490 491
493 494 495 496
497 501 502 503
504 505 506 507
508 509 510 511
512 513 514

T0445

putative phosphatase (GD4050C) from Eubacterium rectale

Target type: Server only

Target sequence:

>T0445 GD4050C, unknown, 264 residues
MIKLIATDIDGTLVKDGSLLIDPEYMSVIDRLIDKGIIFVVCSGRQFSSEFKLFAPIKHKLLYITDGGTVVRTPKEILKTYPMDEDIWKGMCRMVRDELPACDYFAATPDFCFAEDGGSPIFHLLRDSYGFEMREVDDITRLDRNDIIKFTVFHPDKCEELCTPVFIPAWNKKAHLAAAGKEWVDCNAKGVSKWTALSYLIDRFDLLPDEVCCFGDNLNDIEMLQNAGISYAVSNARQEVIAAAKHTCAPYWENGVLSVLKSFL

Structure:
Method: X-ray, res=1.8Å, R/Rfree=0.17/0.21
Determined by: JCSG
PDB ID: 3dao

3dao_A cartoon
Cartoon diagram of 445: 3dao chain A residues

PyMOL of 3dao

Domains:  PyMOL of domains

Two domains. Residue ranges in PDB: 0-81,190-264 and 82-189. Residue ranges in target: 1-81,190-264 and 82-189.

445 domain evaluation plot
Correlation between weighted by the number of residues sum of GDT-TS scores for domain-based evlatuation (y, vertical axis) and whole chain GDT-TS (x, horizontal axis).

To compute the weighted sum, GDT-TS for each domain was multiplied by the domain length, and this sum was divided by the sum of domain lengths. Each point represents first server model. Green, gray and black points are top 10, bottom 25% and the rest of prediction models. Blue line is the best-fit slope line (intersection 0) to the top 10 server models. Red line is the diagonal. Slope and root mean square y-x distance for the top 10 models (average difference between the weighted sum of domain GDT-TS scores and the whole chain GDT-TS score) are shown above the plot.

Structure classification:

HAD-like fold.

CASP category:

Whole chain: Comparative modeling:medium.

1st domain: Comparative modeling:easy. 2nd domain: Comparative modeling:medium.

Closest templates:

1nrw.

Target sequence - PDB file inconsistencies:

T0445    3dao.pdb    T0445.pdb    PyMOL    PyMOL of domains    

T0445    1 -MIKLIATDIDGTLVKDGSLLIDPEYMSVIDRLIDKGIIFVVCSGRQFSSEFKLFAPIKHKLLYITDGGTVVRTPKEILKTYPMDEDIWKGMCRMVRDELPACDYFAATPDFCFAEDGGSPIFHLLRDSYGFEMREVDDITRLDRNDIIKFTVFHPDKCEELCTPVFIPAWNKKAHLAAAGKEWVDCNAKGVSKWTALSYLIDRFDLLPDEVCCFGDNLNDIEMLQNAGISYAVSNARQEVIAAAKHTCAPYWENGVLSVLKSFL 264
           ~||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3daoA    0 GMIKLIATDIDGTLVKDGSLLIDPEYMSVIDRLIDKGIIFVVCSGRQFSSEFKLFAPIKHKLLYITDGGTVVRTPKEILKTYPMDEDIWKGMCRMVRDELPACDYFAATPDFCFAEDGGSPIFHLLRDSYGFEMREVDDITRLDRNDIIKFTVFHPDKCEELCTPVFIPAWNKKAHLAAAGKEWVDCNAKGVSKWTALSYLIDRFDLLPDEVCCFGDNLNDIEMLQNAGISYAVSNARQEVIAAAKHTCAPYWENGVLSVLKSFL 264

Residue change log: change 1, 26, 83, 91, 94, 133, 223, MSE to MET; remove 0 G as it is not present in target sequence;

We suggest to evaluate this target as a single domain spanning whole chain. However, evolutionarily this is a 2-domain protein:

1st domain: target 1-81, 190-264 ; pdb 1-81, 190-264

2nd domain: target 82-189 ; pdb 82-189

Sequence classification:

Haloacid dehalogenase-like hydrolase family Hydrolase_3 in Pfam.

Comments:

This protein is a close homolog of T0505 and is homologous to T0418.

Server predictions:

T0445:pdb 1-264:seq 1-264:CM_medium;   alignment

distribution of first scores
First models for T0445: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

445_1:pdb 1-81,190-264:seq 1-81,190-264:CM_easy;   alignment

distribution of first scores
First models for T0445_1: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

445_2:pdb 82-189:seq 82-189:CM_medium;   alignment

distribution of first scores
First models for T0445_2: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

# GROUP ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ ↓ GROUP #
T0445 445_1 445_2 T0445 445_1 445_2 T0445 445_1 445_2 T0445 445_1 445_2
First score First Z-score Best score Best Z-score
1 PS2−server 74.53 65.31 79.37 88.14 79.49 88.26 66.67 59.41 71.05 2.07 2.04 0.92 1.35 1.12 1.08 -0.05 0.26 0.81 74.53 65.62 79.37 88.14 79.49 88.26 75.93 66.97 75.63 1.74 1.62 0.48 1.30 0.90 0.85 1.12 0.82 1.03 PS2−server 1
2 forecast 73.48 62.18 79.09 87.82 78.10 88.30 68.29 60.26 70.22 1.75 1.35 0.85 1.24 0.73 1.10 0.27 0.40 0.68 73.67 64.08 79.21 87.82 78.10 88.38 68.29 60.26 70.41 1.44 1.24 0.43 1.12 0.29 0.92 -0.32 -0.26 0.20 forecast 2
3 ACOMPMOD 73.39 66.76 75.38 79.81 74.04 80.96 73.38 61.34 72.09 1.72 2.36 -0.13 -1.51 -0.41 -1.86 1.27 0.58 0.97 73.39 66.76 75.38 79.81 74.04 80.96 73.38 61.34 72.09 1.34 1.91 -0.66 -3.33 -1.52 -3.40 0.64 -0.09 0.47 ACOMPMOD 3
4 GS−KudlatyPred 73.01 61.65 78.92 87.18 75.96 88.55 65.74 59.41 69.37 1.60 1.23 0.80 1.02 0.13 1.20 -0.23 0.26 0.55 73.01 61.65 78.92 87.18 75.96 88.55 65.74 59.41 69.37 1.21 0.64 0.35 0.76 -0.66 1.02 -0.80 -0.40 0.04 GS−KudlatyPred 4
5 FAMSD 72.92 63.95 79.09 87.66 77.08 87.75 66.20 57.72 71.01 1.57 1.74 0.85 1.19 0.44 0.88 -0.14 -0.02 0.80 72.92 63.95 79.09 87.66 77.78 87.75 71.53 65.89 71.24 1.18 1.21 0.40 1.03 0.14 0.55 0.29 0.64 0.33 FAMSD 5
6 MUSTER 72.54 60.42 79.83 87.66 78.15 88.23 68.75 59.95 71.06 1.46 0.96 1.04 1.19 0.74 1.07 0.36 0.35 0.81 72.54 60.42 79.83 87.66 78.15 88.23 75.23 69.21 74.91 1.04 0.34 0.61 1.03 0.31 0.83 0.99 1.18 0.92 MUSTER 6
7 YASARA 72.25 57.42 80.86 88.62 78.05 89.35 68.06 60.03 71.53 1.37 0.30 1.32 1.52 0.71 1.53 0.23 0.36 0.88 73.67 59.60 81.23 90.06 82.11 89.83 70.60 62.11 73.66 1.44 0.14 1.01 2.36 2.06 1.76 0.12 0.03 0.72 YASARA 7
8 mariner1 71.69 63.73 74.84 80.29 74.52 80.53 71.53 59.57 71.61 1.20 1.69 -0.28 -1.34 -0.28 -2.04 0.91 0.28 0.90 75.00 67.42 78.80 84.45 74.52 86.14 75.46 66.44 76.17 1.91 2.07 0.32 -0.75 -1.30 -0.39 1.03 0.73 1.12 mariner1 8
9 fais−server 71.59 63.89 73.97 79.97 74.41 82.88 71.53 60.57 65.46 1.17 1.73 -0.50 -1.45 -0.31 -1.09 0.91 0.45 -0.06 71.59 63.89 79.59 87.18 77.89 87.98 71.53 60.57 70.88 0.71 1.20 0.54 0.76 0.19 0.69 0.29 -0.21 0.28 fais−server 9
10 PSI 71.40 63.26 74.58 79.49 72.54 81.42 70.37 59.41 69.38 1.11 1.59 -0.34 -1.62 -0.83 -1.68 0.68 0.26 0.55 71.40 63.26 79.41 86.86 77.40 87.77 70.37 59.41 70.76 0.64 1.04 0.49 0.59 -0.03 0.56 0.07 -0.40 0.26 PSI 10
11 3D−JIGSAW_AEP 71.21 59.98 77.60 87.66 80.72 87.82 65.51 56.71 66.14 1.05 0.87 0.45 1.19 1.46 0.91 -0.27 -0.19 0.05 71.21 60.01 77.60 87.66 80.72 87.82 65.74 57.10 66.14 0.58 0.24 -0.03 1.03 1.45 0.59 -0.80 -0.77 -0.47 3D−JIGSAW_AEP 11
12 FUGUE_KM 70.74 62.85 72.63 79.81 71.05 79.21 71.30 60.26 68.34 0.91 1.50 -0.86 -1.51 -1.25 -2.57 0.86 0.40 0.39 70.74 62.85 72.63 79.81 71.05 79.21 71.30 60.26 68.34 0.41 0.94 -1.44 -3.33 -2.84 -4.42 0.25 -0.26 -0.13 FUGUE_KM 12
13 nFOLD3 70.74 62.78 71.70 80.13 69.66 80.36 70.37 59.88 64.14 0.91 1.48 -1.11 -1.40 -1.64 -2.11 0.68 0.34 -0.27 72.82 63.64 79.90 85.42 75.43 86.80 75.23 65.36 75.43 1.14 1.13 0.63 -0.21 -0.90 -0.00 0.99 0.56 1.00 nFOLD3 13
14 MULTICOM−CMFR 70.45 58.33 79.12 87.34 78.69 88.10 65.74 56.94 69.54 0.82 0.50 0.86 1.08 0.89 1.02 -0.23 -0.15 0.57 80.40 71.12 82.48 88.30 82.53 89.80 77.08 70.76 76.32 3.80 2.98 1.36 1.39 2.25 1.74 1.33 1.43 1.14 MULTICOM−CMFR 14
15 METATASSER 70.27 56.19 78.69 86.38 82.96 87.25 74.07 68.21 68.87 0.76 0.03 0.74 0.75 2.09 0.68 1.40 1.72 0.47 73.96 61.65 80.67 86.54 82.96 87.25 75.46 68.21 74.87 1.54 0.64 0.85 0.41 2.44 0.26 1.03 1.01 0.91 METATASSER 15
16 circle 69.98 61.46 71.70 79.65 74.63 81.08 67.82 51.85 63.20 0.67 1.19 -1.11 -1.56 -0.25 -1.82 0.18 -0.99 -0.41 71.21 63.51 78.84 86.38 76.44 86.81 71.30 64.51 70.88 0.58 1.10 0.33 0.32 -0.45 0.00 0.25 0.42 0.28 circle 16
17 FALCON_CONSENSUS 69.79 60.95 72.46 78.85 72.97 80.92 68.98 60.65 65.02 0.62 1.08 -0.90 -1.84 -0.71 -1.88 0.41 0.46 -0.13 69.79 60.95 80.10 85.10 75.69 86.20 73.15 64.51 74.48 0.08 0.47 0.68 -0.39 -0.78 -0.35 0.59 0.42 0.85 FALCON_CONSENSUS 17
18 FALCON 69.79 60.95 72.46 78.85 72.97 80.92 68.98 60.65 65.02 0.62 1.08 -0.90 -1.84 -0.71 -1.88 0.41 0.46 -0.13 69.79 60.95 80.10 85.10 75.69 86.20 73.15 64.51 74.48 0.08 0.47 0.68 -0.39 -0.78 -0.35 0.59 0.42 0.85 FALCON 18
19 SAM−T06−server 69.79 59.25 79.48 88.14 78.20 87.50 67.13 56.48 71.39 0.62 0.70 0.95 1.35 0.76 0.78 0.04 -0.23 0.86 70.36 62.72 79.48 88.14 78.20 87.50 68.52 63.12 71.39 0.28 0.91 0.51 1.30 0.33 0.41 -0.28 0.20 0.36 SAM−T06−server 19
20 GS−MetaServer2 69.79 58.30 74.58 85.74 76.23 86.60 60.42 49.15 63.11 0.62 0.49 -0.34 0.53 0.20 0.41 -1.27 -1.44 -0.43 69.98 60.89 74.58 85.74 76.23 86.60 69.91 59.65 66.23 0.14 0.45 -0.89 -0.04 -0.54 -0.12 -0.01 -0.36 -0.46 GS−MetaServer2 20
21 pro−sp3−TASSER 69.79 54.48 77.00 86.22 81.09 87.60 72.69 65.74 64.25 0.62 -0.35 0.30 0.69 1.57 0.82 1.13 1.31 -0.25 69.79 58.77 80.83 86.38 81.09 87.60 75.00 69.29 75.38 0.08 -0.07 0.89 0.32 1.61 0.46 0.94 1.19 0.99 pro−sp3−TASSER 21
22 SAM−T08−server 69.70 60.51 79.34 88.30 83.49 88.25 68.29 57.48 69.85 0.59 0.98 0.91 1.41 2.24 1.08 0.27 -0.06 0.62 70.36 60.51 79.34 88.30 83.49 88.25 68.29 57.48 70.26 0.28 0.36 0.47 1.39 2.68 0.84 -0.32 -0.71 0.18 SAM−T08−server 22
23 panther_server 69.51 57.77 72.39 84.61 78.53 84.09 60.88 52.08 61.04 0.53 0.38 -0.92 0.14 0.85 -0.60 -1.18 -0.96 -0.75 69.51 57.77 72.39 84.61 78.53 84.09 68.06 62.96 61.04 -0.02 -0.32 -1.51 -0.66 0.48 -1.58 -0.36 0.17 -1.28 panther_server 23
24 3Dpro 69.22 55.15 74.39 86.06 76.23 85.87 60.19 54.63 62.79 0.44 -0.20 -0.39 0.64 0.20 0.12 -1.32 -0.53 -0.48 69.22 55.15 74.39 86.06 76.23 85.87 60.19 54.63 62.79 -0.12 -0.96 -0.94 0.14 -0.54 -0.54 -1.84 -1.17 -1.01 3Dpro 24
25 HHpred2 69.03 56.53 79.79 87.18 77.14 87.93 67.82 58.87 71.58 0.38 0.10 1.03 1.02 0.46 0.95 0.18 0.17 0.89 69.03 56.53 79.79 87.18 77.14 87.93 67.82 58.87 71.58 -0.19 -0.62 0.60 0.76 -0.14 0.66 -0.41 -0.49 0.39 HHpred2 25
26 Pushchino 69.03 55.40 71.40 86.38 75.48 87.24 58.10 47.76 51.86 0.38 -0.15 -1.18 0.75 -0.01 0.67 -1.73 -1.67 -2.18 69.03 55.40 71.40 86.38 75.48 87.24 58.10 47.76 51.86 -0.19 -0.90 -1.79 0.32 -0.88 0.25 -2.24 -2.28 -2.74 Pushchino 26
27 HHpred4 68.94 57.26 79.59 87.18 77.89 87.98 67.13 58.02 70.88 0.36 0.27 0.98 1.02 0.67 0.97 0.04 0.03 0.78 68.94 57.26 79.59 87.18 77.89 87.98 67.13 58.02 70.88 -0.22 -0.44 0.54 0.76 0.19 0.69 -0.54 -0.63 0.28 HHpred4 27
28 pipe_int 68.94 56.12 79.20 86.06 76.02 87.41 67.59 58.18 70.91 0.36 0.01 0.88 0.64 0.14 0.74 0.13 0.05 0.79 70.83 62.31 80.09 87.82 76.02 87.93 73.15 66.97 74.97 0.44 0.81 0.68 1.12 -0.64 0.66 0.59 0.82 0.93 pipe_int 28
29 MUFOLD−Server 68.75 57.26 78.96 85.90 75.64 87.05 66.90 57.02 70.87 0.30 0.27 0.81 0.58 0.04 0.60 -0.00 -0.14 0.78 68.75 57.29 79.04 86.22 76.92 87.53 67.13 58.33 70.87 -0.29 -0.44 0.38 0.23 -0.24 0.42 -0.54 -0.58 0.28 MUFOLD−Server 29
30 3D−JIGSAW_V3 68.66 56.60 76.97 86.38 75.80 87.45 65.28 50.93 65.01 0.27 0.12 0.29 0.75 0.08 0.76 -0.32 -1.15 -0.13 68.66 58.46 77.30 86.54 76.50 87.47 65.28 55.40 65.80 -0.32 -0.15 -0.11 0.41 -0.42 0.39 -0.89 -1.05 -0.53 3D−JIGSAW_V3 30
31 BAKER−ROBETTA 68.56 57.32 79.67 86.38 73.67 87.58 68.98 59.10 71.75 0.24 0.28 1.00 0.75 -0.51 0.81 0.41 0.21 0.92 68.56 57.70 79.67 86.54 76.98 87.58 68.98 59.88 71.75 -0.36 -0.33 0.56 0.41 -0.21 0.45 -0.19 -0.33 0.42 BAKER−ROBETTA 31
32 Poing 68.37 55.24 77.91 86.06 76.02 87.42 65.74 50.39 67.64 0.18 -0.18 0.54 0.64 0.14 0.75 -0.23 -1.24 0.28 70.93 62.53 77.91 86.06 77.40 87.42 72.69 60.49 67.64 0.48 0.86 0.06 0.14 -0.03 0.36 0.51 -0.23 -0.24 Poing 32
33 Phyre2 68.37 55.24 77.91 86.06 76.02 87.42 65.74 50.39 67.64 0.18 -0.18 0.54 0.64 0.14 0.75 -0.23 -1.24 0.28 70.93 62.53 77.91 86.06 76.02 87.42 72.69 60.49 67.64 0.48 0.86 0.06 0.14 -0.64 0.36 0.51 -0.23 -0.24 Phyre2 33
34 Phragment 68.37 55.24 77.91 86.06 76.02 87.42 65.74 50.39 67.64 0.18 -0.18 0.54 0.64 0.14 0.75 -0.23 -1.24 0.28 70.93 62.53 77.91 86.06 76.02 87.42 72.69 60.49 67.64 0.48 0.86 0.06 0.14 -0.64 0.36 0.51 -0.23 -0.24 Phragment 34
35 Zhang−Server 67.80 54.36 78.09 85.42 75.48 86.46 74.54 68.52 68.88 0.01 -0.38 0.58 0.42 -0.01 0.36 1.50 1.77 0.47 68.56 55.24 78.41 86.38 76.66 87.08 74.54 68.52 68.88 -0.36 -0.94 0.20 0.32 -0.35 0.16 0.86 1.06 -0.04 Zhang−Server 35
36 MULTICOM−RANK 67.80 53.38 80.97 84.61 79.06 87.62 74.77 68.75 73.90 0.01 -0.59 1.35 0.14 1.00 0.83 1.54 1.81 1.25 67.80 53.38 80.97 84.61 79.06 87.62 74.77 68.75 73.90 -0.62 -1.40 0.93 -0.66 0.71 0.48 0.90 1.10 0.76 MULTICOM−RANK 36
37 Pcons_multi 67.42 53.19 80.24 86.70 81.25 88.42 71.53 63.81 70.98 -0.11 -0.63 1.15 0.86 1.61 1.15 0.91 0.99 0.80 69.32 57.45 80.78 87.66 81.25 88.59 71.53 63.81 72.34 -0.09 -0.40 0.88 1.03 1.68 1.04 0.29 0.31 0.51 Pcons_multi 37
38 3DShot2 67.23 57.01 74.67 84.61 81.20 84.03 65.51 55.02 65.13 -0.17 0.21 -0.32 0.14 1.60 -0.62 -0.27 -0.47 -0.11 67.23 57.01 74.67 84.61 81.20 84.03 65.51 55.02 65.13 -0.82 -0.50 -0.86 -0.66 1.66 -1.61 -0.84 -1.11 -0.64 3DShot2 38
39 MULTICOM−REFINE 67.14 55.08 81.42 85.10 77.62 87.84 75.93 68.67 74.86 -0.20 -0.22 1.46 0.31 0.59 0.91 1.77 1.79 1.40 67.42 55.65 81.73 85.42 80.61 88.19 77.08 70.91 75.46 -0.76 -0.84 1.15 -0.21 1.40 0.81 1.33 1.45 1.00 MULTICOM−REFINE 39
40 MUProt 66.76 54.58 81.29 84.30 78.31 87.89 75.93 68.21 74.54 -0.31 -0.33 1.43 0.03 0.79 0.94 1.77 1.72 1.35 66.76 54.58 81.29 84.30 79.70 87.89 75.93 70.14 74.69 -0.99 -1.11 1.02 -0.84 0.99 0.63 1.12 1.33 0.88 MUProt 40
41 Phyre_de_novo 66.67 54.67 77.29 84.78 74.95 87.57 71.99 65.36 65.31 -0.34 -0.31 0.37 0.20 -0.16 0.81 1.00 1.24 -0.08 70.93 62.53 77.91 86.06 76.02 87.57 72.69 65.36 67.64 0.48 0.86 0.06 0.14 -0.64 0.45 0.51 0.56 -0.24 Phyre_de_novo 41
42 LEE−SERVER 66.57 54.26 81.07 84.30 77.46 88.88 72.45 62.11 72.42 -0.37 -0.40 1.37 0.03 0.55 1.34 1.09 0.71 1.02 67.14 55.52 81.21 85.26 79.06 88.88 73.84 63.04 74.24 -0.85 -0.87 1.00 -0.30 0.71 1.21 0.72 0.18 0.81 LEE−SERVER 42
43 FEIG 66.48 48.86 76.54 83.01 76.71 81.99 72.22 61.88 72.13 -0.40 -1.59 0.17 -0.41 0.34 -1.45 1.04 0.67 0.98 70.45 57.77 79.01 87.18 76.71 88.19 73.38 67.44 72.52 0.31 -0.32 0.37 0.76 -0.33 0.81 0.64 0.89 0.54 FEIG 43
44 BioSerf 66.38 54.07 78.49 84.94 75.11 86.01 71.30 66.20 70.37 -0.43 -0.44 0.69 0.25 -0.11 0.18 0.86 1.38 0.70 66.38 54.07 78.49 84.94 75.11 86.01 71.30 66.20 70.37 -1.12 -1.23 0.23 -0.48 -1.04 -0.46 0.25 0.69 0.20 BioSerf 44
45 RAPTOR 65.91 53.66 80.83 84.30 72.22 85.91 74.31 67.36 76.46 -0.57 -0.53 1.31 0.03 -0.92 0.14 1.45 1.57 1.65 73.67 63.57 80.83 87.82 78.85 88.52 76.62 68.21 76.46 1.44 1.12 0.89 1.12 0.62 1.00 1.25 1.01 1.16 RAPTOR 45
46 mGenTHREADER 65.15 53.09 78.45 83.49 76.23 84.92 72.22 66.82 72.08 -0.80 -0.66 0.68 -0.25 0.20 -0.26 1.04 1.49 0.97 65.15 53.09 78.45 83.49 76.23 84.92 72.22 66.82 72.08 -1.55 -1.47 0.22 -1.28 -0.54 -1.10 0.42 0.79 0.47 mGenTHREADER 46
47 GeneSilicoMetaServer 64.96 51.70 76.37 84.45 76.66 84.97 69.91 63.89 66.92 -0.86 -0.96 0.13 0.08 0.32 -0.24 0.59 1.00 0.17 70.74 62.47 77.81 84.45 76.66 85.36 71.53 66.13 69.67 0.41 0.85 0.03 -0.75 -0.35 -0.84 0.29 0.68 0.09 GeneSilicoMetaServer 47
48 FFASflextemplate 64.87 55.97 66.70 85.10 78.58 83.61 53.24 41.20 46.89 -0.89 -0.02 -2.43 0.31 0.86 -0.79 -2.68 -2.76 -2.95 64.87 56.50 66.97 85.10 80.56 84.02 53.24 43.21 46.99 -1.65 -0.63 -3.05 -0.39 1.38 -1.62 -3.15 -3.01 -3.52 FFASflextemplate 48
49 FFASsuboptimal 64.87 54.32 70.09 83.49 68.27 84.56 57.87 46.76 53.56 -0.89 -0.38 -1.53 -0.25 -2.03 -0.41 -1.77 -1.84 -1.91 64.87 54.32 70.37 84.14 75.80 85.15 58.56 48.69 54.03 -1.65 -1.17 -2.08 -0.92 -0.73 -0.96 -2.15 -2.13 -2.40 FFASsuboptimal 49
50 MULTICOM−CLUSTER 64.20 49.05 78.61 81.09 72.97 86.73 72.22 63.12 69.70 -1.10 -1.55 0.72 -1.07 -0.71 0.47 1.04 0.87 0.60 67.80 56.38 82.58 85.26 79.17 88.76 77.08 71.84 76.42 -0.62 -0.66 1.39 -0.30 0.76 1.14 1.33 1.60 1.16 MULTICOM−CLUSTER 50
51 rehtnap 64.11 54.17 66.54 82.21 75.37 81.32 57.64 47.45 50.55 -1.12 -0.42 -2.47 -0.68 -0.04 -1.72 -1.82 -1.72 -2.38 64.68 56.03 67.89 83.01 77.46 82.65 57.64 48.23 51.68 -1.72 -0.75 -2.79 -1.55 0.00 -2.42 -2.32 -2.20 -2.77 rehtnap 51
52 FFASstandard 63.92 55.78 68.17 84.14 65.17 85.40 51.85 42.59 47.60 -1.18 -0.06 -2.04 -0.02 -2.90 -0.07 -2.95 -2.53 -2.84 68.56 55.78 70.46 86.22 77.14 86.18 61.11 48.84 56.71 -0.36 -0.81 -2.06 0.23 -0.14 -0.36 -1.67 -2.10 -1.97 FFASstandard 52
53 Pcons_local 63.83 51.29 71.04 84.94 77.99 85.65 62.96 57.72 53.54 -1.21 -1.05 -1.28 0.25 0.70 0.03 -0.77 -0.02 -1.92 67.99 56.12 74.01 84.94 77.99 86.17 66.20 58.33 59.67 -0.56 -0.72 -1.05 -0.48 0.24 -0.37 -0.71 -0.58 -1.50 Pcons_local 53
54 Pcons_dot_net 63.83 51.29 71.04 84.94 77.99 85.65 62.96 57.72 53.54 -1.21 -1.05 -1.28 0.25 0.70 0.03 -0.77 -0.02 -1.92 69.13 55.49 79.08 86.54 77.99 87.56 72.69 65.28 70.28 -0.16 -0.88 0.39 0.41 0.24 0.44 0.51 0.54 0.18 Pcons_dot_net 54
55 OLGAFS 63.26 51.96 65.61 83.97 66.61 83.71 53.24 41.20 44.54 -1.38 -0.90 -2.71 -0.08 -2.49 -0.75 -2.68 -2.76 -3.32 64.02 53.35 65.61 83.97 72.06 83.71 53.24 41.20 44.54 -1.95 -1.41 -3.44 -1.02 -2.39 -1.80 -3.15 -3.33 -3.90 OLGAFS 55
56 COMA−M 63.26 46.84 74.17 82.69 73.61 85.90 62.96 56.17 59.76 -1.38 -2.04 -0.45 -0.52 -0.53 0.13 -0.77 -0.28 -0.95 65.25 50.03 80.36 83.97 75.05 86.16 79.40 76.31 74.78 -1.52 -2.23 0.76 -1.02 -1.07 -0.37 1.77 2.32 0.90 COMA−M 56
57 SAM−T02−server 62.97 51.36 70.33 82.53 75.69 83.49 64.58 60.57 55.31 -1.47 -1.04 -1.47 -0.57 0.05 -0.84 -0.46 0.45 -1.64 67.42 59.03 72.11 85.58 77.78 86.25 64.58 60.57 55.95 -0.76 -0.01 -1.59 -0.12 0.14 -0.32 -1.02 -0.21 -2.09 SAM−T02−server 57
58 Frankenstein 62.88 50.41 72.82 84.61 69.34 85.51 63.43 55.86 57.60 -1.50 -1.25 -0.81 0.14 -1.73 -0.03 -0.68 -0.33 -1.28 68.75 55.15 79.01 86.22 76.28 87.55 68.29 59.18 70.22 -0.29 -0.96 0.37 0.23 -0.52 0.43 -0.32 -0.44 0.17 Frankenstein 58
59 COMA 62.50 48.99 73.15 81.89 74.52 84.17 60.42 50.69 60.67 -1.62 -1.56 -0.72 -0.79 -0.28 -0.57 -1.27 -1.19 -0.81 73.39 64.61 80.36 87.82 79.17 88.25 74.31 68.13 74.78 1.34 1.37 0.76 1.12 0.76 0.84 0.81 1.00 0.90 COMA 59
60 Distill 61.55 53.91 63.54 76.44 69.82 73.95 54.63 46.45 54.72 -1.91 -0.47 -3.26 -2.67 -1.59 -4.70 -2.41 -1.89 -1.73 61.55 53.91 63.54 77.40 73.98 74.31 56.71 49.92 56.20 -2.82 -1.27 -4.03 -4.67 -1.54 -7.27 -2.50 -1.93 -2.05 Distill 60
61 HHpred5 61.08 47.44 76.11 81.25 73.34 84.17 63.66 56.56 67.83 -2.05 -1.90 0.06 -1.01 -0.61 -0.57 -0.64 -0.21 0.31 61.08 47.44 76.11 81.25 73.34 84.17 63.66 56.56 67.83 -2.98 -2.87 -0.45 -2.53 -1.83 -1.53 -1.19 -0.86 -0.21 HHpred5 61
62 keasar−server 60.98 45.96 74.66 75.80 66.40 83.49 65.51 56.56 65.44 -2.08 -2.23 -0.32 -2.89 -2.55 -0.84 -0.27 -0.21 -0.06 71.21 63.19 80.28 85.58 77.62 86.59 73.38 68.60 73.90 0.58 1.02 0.74 -0.12 0.07 -0.12 0.64 1.08 0.76 keasar−server 62
63 Fiser−M4T 59.09 44.70 70.08 77.72 67.04 82.51 55.56 45.37 56.22 -2.66 -2.51 -1.53 -2.23 -2.37 -1.24 -2.22 -2.07 -1.50 59.09 44.70 70.08 77.72 67.04 82.51 55.56 45.37 56.22 -3.68 -3.55 -2.17 -4.49 -4.62 -2.50 -2.71 -2.66 -2.05 Fiser−M4T 63
64 huber−torda−server 58.62 44.22 70.45 75.16 63.52 83.17 60.42 53.94 55.36 -2.80 -2.61 -1.44 -3.11 -3.36 -0.97 -1.27 -0.65 -1.63 65.81 51.29 74.55 85.90 74.79 85.72 70.14 64.43 64.99 -1.32 -1.92 -0.89 0.05 -1.18 -0.63 0.03 0.41 -0.66 huber−torda−server 64
65 CpHModels 57.48 42.96 68.20 73.72 58.65 80.77 57.87 46.60 54.31 -3.15 -2.89 -2.03 -3.60 -4.72 -1.94 -1.77 -1.86 -1.80 57.48 42.96 68.20 73.72 58.65 80.77 57.87 46.60 54.31 -4.25 -3.98 -2.70 -6.71 -8.34 -3.51 -2.28 -2.46 -2.35 CpHModels 65
66 MUFOLD−MD 17.23 15.34 36.72 28.53 25.32 42.32 28.01 26.00 42.20 -15.48 -8.99 -10.35 -19.12 -14.06 -17.48 -7.62 -5.27 -3.68 17.23 15.34 38.21 28.53 25.32 42.94 34.72 29.17 44.41 -18.38 -10.81 -11.23 -31.81 -23.12 -25.54 -6.63 -5.27 -3.93 MUFOLD−MD 66
67 FOLDpro 15.53 12.78 18.28 23.08 15.97 26.75 18.52 17.05 21.41 -16.00 -9.55 -15.23 -21.00 -16.68 -23.77 -9.48 -6.76 -6.91 18.84 13.26 23.61 29.97 21.05 34.95 23.38 19.06 26.14 -17.82 -11.32 -15.38 -31.01 -25.01 -30.19 -8.77 -6.90 -6.83 FOLDpro 67
68 RBO−Proteus 12.78 10.73 32.07 21.15 17.20 37.69 25.00 22.92 38.11 -16.84 -10.01 -11.58 -21.66 -16.34 -19.35 -8.21 -5.78 -4.32 15.53 13.16 36.08 21.95 18.59 39.38 34.03 25.46 45.07 -18.98 -11.35 -11.84 -35.46 -26.11 -27.61 -6.76 -5.87 -3.82 RBO−Proteus 68
69 RANDOM 9.24 7.72 9.24 16.81 13.99 16.81 18.21 15.08 18.21 -17.92 -10.67 -17.62 -23.15 -17.24 -27.78 -9.54 -7.08 -7.41 9.24 7.72 9.24 16.81 13.99 16.81 18.21 15.08 18.21 -21.19 -12.69 -19.47 -38.32 -28.15 -40.75 -9.74 -7.54 -8.09 RANDOM 69
70 schenk−torda−server 7.20 5.68 7.39 12.02 9.46 14.74 13.43 11.57 13.87 -18.55 -11.12 -18.10 -24.80 -18.51 -28.62 -10.48 -7.66 -8.09 9.00 8.05 10.33 13.14 12.07 16.23 16.43 13.04 18.14 -21.27 -12.61 -19.16 -40.36 -29.00 -41.09 -10.07 -7.87 -8.10 schenk−torda−server 70
71 BHAGEERATH                                                       -17.92 -10.67 -17.62 -23.15 -17.24 -27.78 -9.54 -7.08 -7.41                                                       -21.19 -12.69 -19.47 -38.32 -28.15 -40.75 -9.74 -7.54 -8.09 BHAGEERATH 71
72 LOOPP_Server                                                       -17.92 -10.67 -17.62 -23.15 -17.24 -27.78 -9.54 -7.08 -7.41                                                       -21.19 -12.69 -19.47 -38.32 -28.15 -40.75 -9.74 -7.54 -8.09 LOOPP_Server 72
73 mahmood−torda−server                                                       -17.92 -10.67 -17.62 -23.15 -17.24 -27.78 -9.54 -7.08 -7.41                                                       -21.19 -12.69 -19.47 -38.32 -28.15 -40.75 -9.74 -7.54 -8.09 mahmood−torda−server 73
74 test_http_server_01                                                       -17.92 -10.67 -17.62 -23.15 -17.24 -27.78 -9.54 -7.08 -7.41                                                       -21.19 -12.69 -19.47 -38.32 -28.15 -40.75 -9.74 -7.54 -8.09 test_http_server_01 74