T0439

X-ray Targets
387 388 389 390
391 392 393 394
395 396 397 398
399 400 401 402
403 404 405 406
407 408 409 410
411 412 413 414
415 416 417 418
419 420 421 422
423 424 425 426
427 428 429 430
431 432 433 434
435 436 438 439
440 441 442 443
444 445 446 447
448 449 450 451
452 453 454 455
456 457 458 459
461 463 465 470
477 478 479 481
483 485 486 487
488 489 490 491
493 494 495 496
497 501 502 503
504 505 506 507
508 509 510 511
512 513 514

T0439

TrpR binding protein WrbA Agrobacterium tumefaciens str. C58

Target type: Server only

Target sequence:

>T0439 TrpR binding protein WrbA, Agrobacterium tumefaciens str. C58, 223 residues
MIIEFLKKLLAGTPETVPAKETKRMTKVLVLYYSSYGHIETMAYAVAEGVESTGAEAVVKRVPELVPEEVAKSSHFKMDQPAPVATVDELAEYDAIIVGAGTRFGTVASQMRNFWDQTGGLWFSGKLVGKVGSAFTSSATQHGGQESTILGFIPTFLHHGMAVVGLPYAFQGQMGVDEIKGGSPYGASTITDGDGSRQPSAIELDAARYQGAHVAKLAAKLSA

Structure:
No structure will be available any time soon.
Could be determined by: MCSG

Domains:

Single domain protein.

Structure classification:

Flavodoxin fold.

CASP category:

Unknown.

Closest templates:

5nul.

Target sequence - PDB file inconsistencies:

N/A - no structure

Sequence classification:

Flavodoxin (Flavodoxin_1) family in Pfam.

Server predictions:

Will be added here at some point.