T0387

X-ray Targets
387 388 389 390
391 392 393 394
395 396 397 398
399 400 401 402
403 404 405 406
407 408 409 410
411 412 413 414
415 416 417 418
419 420 421 422
423 424 425 426
427 428 429 430
431 432 433 434
435 436 438 439
440 441 442 443
444 445 446 447
448 449 450 451
452 453 454 455
456 457 458 459
461 463 465 470
477 478 479 481
483 485 486 487
488 489 490 491
493 494 495 496
497 501 502 503
504 505 506 507
508 509 510 511
512 513 514

T0387

4th PDZ domain of PDZ domain containing protein 1 (PDZK1A) from Homo sapiens

Target type: Human/Server

Target sequence:

>T0387 PDZK1A, Homo sapiens, 91 residues
SMKPKLCRLAKGENGYGFHLNAIRGLPGSFIKEVQKGGPADLAGLEDEDVIIEVNGVNVLDEPYEKVVDRIQSSGKNVTLLVCGKKAQDTV

Structure:
Method: X-ray, res=2.4Å, R/Rfree=0.22/0.27
Determined by: SGC
PDB ID: 2vsp
(not yet released,
available here)

2vsp_A cartoon
Cartoon diagram of 387: 2vsp chain A

PyMOL of 2vsp

Domains:  PyMOL of domains

Single domain protein.

Structure classification:

PDZ domain fold.

CASP category:

Comparative modeling:easy.

Closest templates:

2ozf, 2he4, 1g9o, 2v90, 1q3o, 2ego.

Target sequence - PDB file inconsistencies:

T0387    2vsp.pdb    T0387.pdb    PyMOL    PyMOL of domains    

T0387    1 SMKPKLCRLAKGENGYGFHLNAIRGLPGSFIKEVQKGGPADLAGLEDEDVIIEVNGVNVLDEPYEKVVDRIQSSGKNVTLLVCGKKAQDTV 91
           ~:||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~
2vspA    2 -AKPKLCRLAKGENGYGFHLNAIRGLPGSFIKEVQKGGPADLAGLEDEDVIIEVNGVNVLDEPYEKVVDRIQSSGKNVTLLVCG------- 84

Residue change log: change 2 A to M;

Single domain protein: target 2-84 ; pdb 2-84

Sequence classification:

PDZ domain (PF00595) in Pfam.

Server predictions:

T0387:pdb 2-84:seq 2-84:CM_easy;   alignment

distribution of first scores
First models for T0387: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

# GROUP ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ ↓ GROUP #
T0387 T0387 T0387 T0387
First score First Z-score Best score Best Z-score
1 LEE 96.08 95.68 93.53 1.59 1.70 1.22 96.08 95.68 93.71 1.71 1.56 1.17 LEE 1
2 DelCLab 95.78 95.78 92.22 1.48 1.72 0.84 95.78 95.78 92.22 1.56 1.58 0.59 DelCLab 2
3 Zico 95.78 94.98 92.54 1.48 1.57 0.93 95.78 94.98 92.54 1.56 1.40 0.71 Zico 3
4 ZicoFullSTP 95.78 94.98 92.54 1.48 1.57 0.93 95.78 94.98 92.54 1.56 1.40 0.71 ZicoFullSTP 4
5 MULTICOM−CLUSTER 95.48 94.68 91.81 1.37 1.52 0.72 95.48 94.68 92.60 1.40 1.33 0.74 MULTICOM−CLUSTER 5
6 LEE−SERVER 95.48 93.47 92.55 1.37 1.31 0.94 96.08 95.38 92.69 1.71 1.49 0.77 LEE−SERVER 6
7 IBT_LT 95.48 87.05 90.86 1.37 0.16 0.45 95.48 87.05 90.86 1.40 -0.46 0.06 IBT_LT 7
8 MULTICOM 94.88 94.88 93.16 1.16 1.56 1.11 95.18 94.88 93.33 1.25 1.37 1.02 MULTICOM 8
9 CBSU 94.88 93.27 90.91 1.16 1.27 0.47 94.88 93.67 91.30 1.09 1.09 0.23 CBSU 9
10 TsaiLab 94.88 92.07 91.57 1.16 1.06 0.66 94.88 93.37 92.06 1.09 1.02 0.53 TsaiLab 10
11 MULTICOM−REFINE 94.88 91.87 92.96 1.16 1.02 1.05 94.88 94.88 92.96 1.09 1.37 0.88 MULTICOM−REFINE 11
12 MUSTER 94.88 91.27 91.77 1.16 0.91 0.71 94.88 92.27 93.40 1.09 0.76 1.05 MUSTER 12
13 MULTICOM−CMFR 94.88 82.43 92.47 1.16 -0.66 0.91 95.18 94.08 92.78 1.25 1.19 0.81 MULTICOM−CMFR 13
14 mufold 94.88 82.03 92.87 1.16 -0.73 1.03 94.88 82.03 92.87 1.09 -1.64 0.84 mufold 14
15 3D−JIGSAW_V3 94.58 93.78 90.87 1.05 1.36 0.46 94.58 93.78 92.08 0.94 1.11 0.53 3D−JIGSAW_V3 15
16 FrankensteinLong 94.58 93.37 93.30 1.05 1.29 1.15 95.78 94.88 93.30 1.56 1.37 1.01 FrankensteinLong 16
17 FAMSD 94.58 92.97 91.75 1.05 1.22 0.71 94.58 92.97 91.75 0.94 0.92 0.41 FAMSD 17
18 3DShotMQ 94.58 92.57 91.43 1.05 1.15 0.62 94.58 92.57 91.43 0.94 0.83 0.28 3DShotMQ 18
19 MUProt 94.58 92.17 92.58 1.05 1.07 0.94 94.88 94.18 92.58 1.09 1.21 0.73 MUProt 19
20 MULTICOM−RANK 94.58 82.93 93.14 1.05 -0.57 1.10 95.48 95.08 93.14 1.40 1.42 0.95 MULTICOM−RANK 20
21 FEIG 94.28 94.28 92.24 0.94 1.45 0.85 94.28 94.28 92.24 0.78 1.23 0.60 FEIG 21
22 HHpred2 94.28 88.66 93.31 0.94 0.45 1.15 94.28 88.66 93.31 0.78 -0.09 1.02 HHpred2 22
23 POEM 93.98 93.17 89.64 0.84 1.25 0.10 93.98 93.17 91.56 0.62 0.97 0.33 POEM 23
24 Jiang_Zhu 93.98 93.17 92.34 0.84 1.25 0.88 93.98 93.17 92.34 0.62 0.97 0.64 Jiang_Zhu 24
25 FAMS−multi 93.98 88.75 92.19 0.84 0.46 0.83 93.98 91.57 92.32 0.62 0.60 0.63 FAMS−multi 25
26 Elofsson 93.98 85.94 93.06 0.84 -0.04 1.08 93.98 85.94 93.09 0.62 -0.72 0.93 Elofsson 26
27 fleil 93.98 82.33 87.23 0.84 -0.68 -0.58 93.98 90.96 87.41 0.62 0.45 -1.29 fleil 27
28 HCA 93.67 89.46 88.87 0.73 0.59 -0.12 93.67 89.46 88.87 0.46 0.10 -0.72 HCA 28
29 LevittGroup 93.67 87.05 91.06 0.73 0.16 0.51 96.08 96.08 92.54 1.71 1.65 0.71 LevittGroup 29
30 Zhang−Server 93.67 84.84 92.10 0.73 -0.23 0.81 93.98 85.14 92.56 0.62 -0.91 0.72 Zhang−Server 30
31 Sternberg 93.67 84.64 91.28 0.73 -0.27 0.57 93.67 84.64 91.28 0.46 -1.03 0.22 Sternberg 31
32 CpHModels 93.07 92.47 88.82 0.51 1.13 -0.13 93.07 92.47 88.82 0.15 0.81 -0.74 CpHModels 32
33 SHORTLE 93.07 90.46 91.15 0.51 0.77 0.54 93.07 90.46 91.15 0.15 0.34 0.17 SHORTLE 33
34 Chicken_George 93.07 89.86 89.79 0.51 0.66 0.15 93.07 89.86 89.79 0.15 0.20 -0.36 Chicken_George 34
35 Poing 93.07 87.45 90.92 0.51 0.23 0.47 93.07 91.06 92.21 0.15 0.48 0.59 Poing 35
36 Phyre2 93.07 87.45 90.92 0.51 0.23 0.47 93.07 91.06 92.21 0.15 0.48 0.59 Phyre2 36
37 Phyre_de_novo 93.07 87.45 90.92 0.51 0.23 0.47 93.07 91.06 92.21 0.15 0.48 0.59 Phyre_de_novo 37
38 Phragment 93.07 87.45 90.92 0.51 0.23 0.47 93.07 91.06 92.21 0.15 0.48 0.59 Phragment 38
39 ZicoFullSTPFullData 93.07 85.44 91.90 0.51 -0.12 0.75 95.78 94.98 92.54 1.56 1.40 0.71 ZicoFullSTPFullData 39
40 COMA 92.77 92.77 91.18 0.40 1.18 0.54 92.77 92.77 91.18 -0.00 0.88 0.18 COMA 40
41 POEMQA 92.77 92.37 88.78 0.40 1.11 -0.14 93.67 93.07 91.56 0.46 0.95 0.33 POEMQA 41
42 Bilab−UT 92.77 90.36 90.99 0.40 0.75 0.49 92.77 90.36 90.99 -0.00 0.31 0.11 Bilab−UT 42
43 Zhang 92.77 84.54 91.02 0.40 -0.28 0.50 93.98 86.34 92.15 0.62 -0.63 0.56 Zhang 43
44 HHpred5 92.77 81.93 92.43 0.40 -0.75 0.90 92.77 81.93 92.43 -0.00 -1.66 0.67 HHpred5 44
45 3DShot1 92.77 81.12 91.98 0.40 -0.89 0.77 92.77 81.12 91.98 -0.00 -1.85 0.50 3DShot1 45
46 DBAKER 92.47 88.45 92.33 0.30 0.41 0.87 93.37 89.36 92.37 0.31 0.08 0.65 DBAKER 46
47 YASARA 92.47 80.42 90.88 0.30 -1.02 0.46 96.39 94.48 92.24 1.87 1.28 0.60 YASARA 47
48 GeneSilico 92.47 78.01 92.56 0.30 -1.45 0.94 92.47 82.73 92.56 -0.16 -1.48 0.72 GeneSilico 48
49 PS2−server 92.17 90.56 84.61 0.19 0.79 -1.33 93.67 90.56 92.32 0.46 0.36 0.63 PS2−server 49
50 PS2−manual 92.17 90.56 84.61 0.19 0.79 -1.33 93.67 90.56 92.32 0.46 0.36 0.63 PS2−manual 50
51 BioSerf 92.17 90.36 84.84 0.19 0.75 -1.27 92.17 90.36 84.84 -0.31 0.31 -2.30 BioSerf 51
52 ProtAnG 92.17 89.76 84.44 0.19 0.64 -1.38 92.17 89.76 84.44 -0.31 0.17 -2.46 ProtAnG 52
53 forecast 92.17 80.52 92.43 0.19 -1.00 0.90 92.17 81.02 92.43 -0.31 -1.88 0.67 forecast 53
54 pipe_int 91.87 91.06 90.10 0.08 0.88 0.24 93.37 92.57 92.21 0.31 0.83 0.59 pipe_int 54
55 FFASstandard 91.87 90.66 84.65 0.08 0.81 -1.32 93.07 92.27 89.68 0.15 0.76 -0.41 FFASstandard 55
56 keasar−server 91.87 90.66 86.07 0.08 0.81 -0.92 91.87 90.66 92.17 -0.47 0.38 0.57 keasar−server 56
57 FFASflextemplate 91.87 90.66 84.65 0.08 0.81 -1.32 92.17 90.66 86.46 -0.31 0.38 -1.67 FFASflextemplate 57
58 FFASsuboptimal 91.87 90.66 84.65 0.08 0.81 -1.32 91.87 90.66 85.15 -0.47 0.38 -2.18 FFASsuboptimal 58
59 Fiser−M4T 91.87 90.46 84.85 0.08 0.77 -1.27 91.87 90.46 84.85 -0.47 0.34 -2.30 Fiser−M4T 59
60 BAKER−ROBETTA 91.87 90.26 85.15 0.08 0.73 -1.18 92.17 90.26 85.65 -0.31 0.29 -1.98 BAKER−ROBETTA 60
61 fais−server 91.87 90.26 84.99 0.08 0.73 -1.23 95.78 94.98 92.23 1.56 1.40 0.59 fais−server 61
62 fais@hgc 91.87 90.26 84.99 0.08 0.73 -1.23 93.67 90.26 92.10 0.46 0.29 0.54 fais@hgc 62
63 ABIpro 91.87 90.26 85.15 0.08 0.73 -1.18 91.87 90.26 85.15 -0.47 0.29 -2.18 ABIpro 63
64 Nano_team 91.87 90.26 85.64 0.08 0.73 -1.04 91.87 90.26 85.64 -0.47 0.29 -1.99 Nano_team 64
65 3Dpro 91.87 90.06 84.72 0.08 0.70 -1.30 91.87 90.06 84.72 -0.47 0.24 -2.35 3Dpro 65
66 StruPPi 91.87 87.85 87.64 0.08 0.30 -0.47 91.87 87.85 87.64 -0.47 -0.28 -1.20 StruPPi 66
67 Frankenstein 91.87 87.45 91.99 0.08 0.23 0.78 92.77 87.45 91.99 -0.00 -0.37 0.50 Frankenstein 67
68 McGuffin 91.87 87.45 91.99 0.08 0.23 0.78 94.28 88.66 93.31 0.78 -0.09 1.02 McGuffin 68
69 Softberry 91.87 85.04 84.21 0.08 -0.20 -1.45 91.87 90.26 92.19 -0.47 0.29 0.58 Softberry 69
70 PZ−UAM 91.57 90.36 84.39 -0.03 0.75 -1.40 91.57 90.36 84.39 -0.62 0.31 -2.48 PZ−UAM 70
71 EB_AMU_Physics 91.57 90.36 84.39 -0.03 0.75 -1.40 91.57 90.36 92.23 -0.62 0.31 0.59 EB_AMU_Physics 71
72 PRI−Yang−KiharA 91.57 89.76 84.72 -0.03 0.64 -1.30 91.57 89.76 84.72 -0.62 0.17 -2.35 PRI−Yang−KiharA 72
73 JIVE08 91.57 88.75 85.11 -0.03 0.46 -1.19 93.07 91.47 87.59 0.15 0.57 -1.22 JIVE08 73
74 GS−KudlatyPred 91.57 83.53 92.15 -0.03 -0.46 0.82 93.37 88.75 92.15 0.31 -0.06 0.56 GS−KudlatyPred 74
75 AMU−Biology 91.57 82.73 92.08 -0.03 -0.61 0.80 91.57 82.73 92.08 -0.62 -1.48 0.53 AMU−Biology 75
76 TJ_Jiang 91.57 81.53 91.71 -0.03 -0.82 0.70 93.37 91.97 91.71 0.31 0.69 0.39 TJ_Jiang 76
77 MidwayFolding 91.57 81.53 92.77 -0.03 -0.82 1.00 91.57 81.53 92.77 -0.62 -1.76 0.80 MidwayFolding 77
78 mariner1 91.57 81.12 90.33 -0.03 -0.89 0.30 91.57 90.66 92.14 -0.62 0.38 0.56 mariner1 78
79 tripos_08 91.27 88.05 86.95 -0.13 0.34 -0.67 91.27 88.05 86.95 -0.78 -0.23 -1.47 tripos_08 79
80 fams−ace2 91.27 87.65 91.45 -0.13 0.27 0.62 93.37 91.57 91.45 0.31 0.60 0.29 fams−ace2 80
81 mti 91.27 85.24 92.21 -0.13 -0.16 0.84 91.57 87.35 92.27 -0.62 -0.39 0.61 mti 81
82 3D−JIGSAW_AEP 91.27 82.83 92.05 -0.13 -0.59 0.79 91.27 82.83 92.06 -0.78 -1.45 0.53 3D−JIGSAW_AEP 82
83 mGenTHREADER 91.27 81.22 92.21 -0.13 -0.88 0.84 91.27 81.22 92.21 -0.78 -1.83 0.59 mGenTHREADER 83
84 Pushchino 91.27 81.22 92.21 -0.13 -0.88 0.84 91.27 81.22 92.21 -0.78 -1.83 0.59 Pushchino 84
85 nFOLD3 91.27 81.22 92.21 -0.13 -0.88 0.84 93.07 87.45 92.31 0.15 -0.37 0.62 nFOLD3 85
86 TWPPLAB 91.27 81.22 92.21 -0.13 -0.88 0.84 91.27 81.22 92.21 -0.78 -1.83 0.59 TWPPLAB 86
87 SAM−T02−server 91.27 81.22 92.21 -0.13 -0.88 0.84 93.07 90.06 92.21 0.15 0.24 0.59 SAM−T02−server 87
88 SAM−T06−server 91.27 81.22 92.21 -0.13 -0.88 0.84 92.47 91.06 92.21 -0.16 0.48 0.59 SAM−T06−server 88
89 RAPTOR 91.27 80.02 91.98 -0.13 -1.09 0.77 91.27 80.02 91.98 -0.78 -2.11 0.50 RAPTOR 89
90 3DShot2 91.27 77.21 91.67 -0.13 -1.59 0.68 91.27 77.21 91.67 -0.78 -2.77 0.37 3DShot2 90
91 GS−MetaServer2 90.96 90.16 88.15 -0.24 0.72 -0.32 93.37 90.56 90.72 0.31 0.36 0.00 GS−MetaServer2 91
92 PSI 90.96 87.35 91.87 -0.24 0.22 0.74 91.27 87.35 92.21 -0.78 -0.39 0.59 PSI 92
93 GeneSilicoMetaServer 90.96 81.33 92.37 -0.24 -0.86 0.88 92.77 91.06 92.47 -0.00 0.48 0.69 GeneSilicoMetaServer 93
94 TASSER 90.96 80.92 90.18 -0.24 -0.93 0.26 91.27 85.24 92.21 -0.78 -0.89 0.59 TASSER 94
95 Jones−UCL 90.66 82.23 89.99 -0.35 -0.70 0.20 90.66 82.23 89.99 -1.09 -1.59 -0.28 Jones−UCL 95
96 Pcons_multi 90.36 89.96 90.22 -0.46 0.68 0.27 92.47 89.96 92.61 -0.16 0.22 0.74 Pcons_multi 96
97 MUFOLD−Server 90.36 87.95 90.58 -0.46 0.32 0.37 91.87 87.95 90.58 -0.47 -0.25 -0.05 MUFOLD−Server 97
98 MUFOLD−MD 90.36 87.95 90.58 -0.46 0.32 0.37 91.87 87.95 90.58 -0.47 -0.25 -0.05 MUFOLD−MD 98
99 SAM−T08−human 90.36 82.13 91.09 -0.46 -0.71 0.52 92.77 86.85 93.12 -0.00 -0.51 0.94 SAM−T08−human 99
100 circle 90.36 80.32 89.64 -0.46 -1.04 0.10 92.17 82.53 91.79 -0.31 -1.52 0.42 circle 100
101 xianmingpan 89.16 85.54 83.02 -0.89 -0.11 -1.79 89.16 86.95 86.35 -1.87 -0.49 -1.71 xianmingpan 101
102 Bates_BMM 89.16 81.33 87.97 -0.89 -0.86 -0.37 91.87 85.74 90.02 -0.47 -0.77 -0.27 Bates_BMM 102
103 pro−sp3−TASSER 89.16 80.32 86.26 -0.89 -1.04 -0.86 92.47 85.24 92.21 -0.16 -0.89 0.59 pro−sp3−TASSER 103
104 SAM−T08−server 89.16 73.49 91.45 -0.89 -2.25 0.62 92.47 86.85 92.21 -0.16 -0.51 0.59 SAM−T08−server 104
105 Distill 89.16 69.68 83.53 -0.89 -2.93 -1.64 89.16 83.94 85.85 -1.87 -1.19 -1.90 Distill 105
106 rehtnap 88.86 87.05 90.03 -1.00 0.16 0.22 94.58 92.17 91.51 0.94 0.74 0.31 rehtnap 106
107 COMA−M 88.86 85.24 87.46 -1.00 -0.16 -0.52 92.17 88.96 90.96 -0.31 -0.02 0.10 COMA−M 107
108 METATASSER 88.55 80.12 85.20 -1.11 -1.07 -1.17 93.07 88.15 90.61 0.15 -0.21 -0.04 METATASSER 108
109 ACOMPMOD 88.25 83.43 88.22 -1.21 -0.48 -0.30 88.25 83.43 88.22 -2.34 -1.31 -0.98 ACOMPMOD 109
110 Hao_Kihara 88.25 81.83 87.60 -1.21 -0.77 -0.48 93.67 93.07 89.07 0.46 0.95 -0.64 Hao_Kihara 110
111 sessions 87.95 83.94 87.81 -1.32 -0.39 -0.42 90.96 89.76 87.81 -0.94 0.17 -1.14 sessions 111
112 panther_server 87.65 80.82 85.35 -1.43 -0.95 -1.12 92.47 90.86 89.04 -0.16 0.43 -0.66 panther_server 112
113 HHpred4 86.75 86.34 90.53 -1.75 0.04 0.36 86.75 86.34 90.53 -3.12 -0.63 -0.07 HHpred4 113
114 FUGUE_KM 86.45 77.81 85.15 -1.86 -1.48 -1.18 87.05 79.42 85.15 -2.96 -2.25 -2.18 FUGUE_KM 114
115 Abagyan 86.14 76.10 79.60 -1.97 -1.79 -2.77 87.65 84.84 83.25 -2.65 -0.98 -2.92 Abagyan 115
116 ricardo 85.84 78.41 89.02 -2.07 -1.38 -0.07 87.05 84.04 89.02 -2.96 -1.17 -0.66 ricardo 116
117 A−TASSER 84.04 78.41 83.24 -2.72 -1.38 -1.73 88.86 83.43 87.30 -2.03 -1.31 -1.34 A−TASSER 117
118 FALCON 83.73 72.09 79.10 -2.83 -2.50 -2.91 83.73 72.09 79.10 -4.68 -3.97 -4.55 FALCON 118
119 OLGAFS 83.43 77.21 86.61 -2.94 -1.59 -0.76 83.43 79.22 86.87 -4.84 -2.30 -1.51 OLGAFS 119
120 SMEG−CCP 82.23 74.60 77.26 -3.37 -2.06 -3.44 82.23 74.60 77.26 -5.46 -3.38 -5.27 SMEG−CCP 120
121 keasar 80.72 72.89 80.70 -3.91 -2.36 -2.45 88.55 84.14 87.07 -2.19 -1.15 -1.43 keasar 121
122 Ozkan−Shell 77.71 68.07 78.89 -4.98 -3.22 -2.97 81.33 76.91 82.96 -5.93 -2.84 -3.04 Ozkan−Shell 122
123 Pcons_local 74.70 66.27 67.11 -6.06 -3.54 -6.34 91.27 80.82 92.38 -0.78 -1.92 0.65 Pcons_local 123
124 Pcons_dot_net 74.70 66.27 67.11 -6.06 -3.54 -6.34 91.87 89.66 92.38 -0.47 0.15 0.65 Pcons_dot_net 124
125 FALCON_CONSENSUS 66.27 53.81 67.95 -9.07 -5.76 -6.10 66.27 53.81 67.95 -13.73 -8.26 -8.91 FALCON_CONSENSUS 125
126 FOLDpro 56.33 44.88 52.20 -12.63 -7.35 -10.60 76.51 67.07 67.29 -8.42 -5.15 -9.17 FOLDpro 126
127 FLOUDAS 54.82 38.76 48.89 -13.17 -8.44 -11.55 55.42 41.57 49.86 -19.35 -11.12 -15.99 FLOUDAS 127
128 DistillSN 46.69 36.04 46.74 -16.08 -8.92 -12.16 46.69 36.04 46.74 -23.87 -12.42 -17.21 DistillSN 128
129 RBO−Proteus 34.94 28.11 41.17 -20.28 -10.34 -13.75 48.19 45.18 53.29 -23.09 -10.28 -14.65 RBO−Proteus 129
130 MeilerLabRene 25.30 21.89 30.20 -23.72 -11.44 -16.89 25.60 21.89 30.20 -34.79 -15.74 -23.69 MeilerLabRene 130
131 BHAGEERATH 23.49 21.39 22.39 -24.37 -11.53 -19.12 27.41 24.80 24.65 -33.85 -15.06 -25.86 BHAGEERATH 131
132 mahmood−torda−server 21.99 20.08 23.22 -24.91 -11.77 -18.89 23.19 20.08 25.33 -36.04 -16.16 -25.59 mahmood−torda−server 132
133 schenk−torda−server 21.39 17.17 26.02 -25.12 -12.29 -18.09 21.69 18.07 26.02 -36.82 -16.63 -25.32 schenk−torda−server 133
134 RANDOM 21.10 17.25 21.10 -25.23 -12.27 -19.49 21.10 17.25 21.10 -37.12 -16.83 -27.25 RANDOM 134
135 psiphifoldings 15.96 14.96 19.04 -27.06 -12.68 -20.08 15.96 14.96 19.04 -39.78 -17.36 -28.05 psiphifoldings 135
136 Kolinski 0.00 0.00 24.83 -32.77 -15.34 -18.43 92.47 86.45 85.41 -0.16 -0.60 -2.08 Kolinski 136
137 FEIG_REFINE                   -25.23 -12.27 -19.49                   -37.12 -16.83 -27.25 FEIG_REFINE 137
138 Handl−Lovell                   -25.23 -12.27 -19.49                   -37.12 -16.83 -27.25 Handl−Lovell 138
139 KudlatyPredHuman                   -25.23 -12.27 -19.49                   -37.12 -16.83 -27.25 KudlatyPredHuman 139
140 LOOPP_Server                   -25.23 -12.27 -19.49                   -37.12 -16.83 -27.25 LOOPP_Server 140
141 Linnolt−UH−CMB                   -25.23 -12.27 -19.49                   -37.12 -16.83 -27.25 Linnolt−UH−CMB 141
142 NIM2                   -25.23 -12.27 -19.49                   -37.12 -16.83 -27.25 NIM2 142
143 NirBenTal                   -25.23 -12.27 -19.49                   -37.12 -16.83 -27.25 NirBenTal 143
144 PHAISTOS                   -25.23 -12.27 -19.49                   -37.12 -16.83 -27.25 PHAISTOS 144
145 POISE                   -25.23 -12.27 -19.49                   -37.12 -16.83 -27.25 POISE 145
146 ProteinShop                   -25.23 -12.27 -19.49                   -37.12 -16.83 -27.25 ProteinShop 146
147 RPFM                   -25.23 -12.27 -19.49                   -37.12 -16.83 -27.25 RPFM 147
148 SAINT1                   -25.23 -12.27 -19.49                   -37.12 -16.83 -27.25 SAINT1 148
149 SAMUDRALA                   -25.23 -12.27 -19.49                   -37.12 -16.83 -27.25 SAMUDRALA 149
150 Sasaki−Cetin−Sasai                   -25.23 -12.27 -19.49                   -37.12 -16.83 -27.25 Sasaki−Cetin−Sasai 150
151 Scheraga                   -25.23 -12.27 -19.49                   -37.12 -16.83 -27.25 Scheraga 151
152 ShakAbInitio                   -25.23 -12.27 -19.49                   -37.12 -16.83 -27.25 ShakAbInitio 152
153 UCDavisGenome                   -25.23 -12.27 -19.49                   -37.12 -16.83 -27.25 UCDavisGenome 153
154 Wolfson−FOBIA                   -25.23 -12.27 -19.49                   -37.12 -16.83 -27.25 Wolfson−FOBIA 154
155 Wolynes                   -25.23 -12.27 -19.49                   -37.12 -16.83 -27.25 Wolynes 155
156 YASARARefine                   -25.23 -12.27 -19.49                   -37.12 -16.83 -27.25 YASARARefine 156
157 Zhou−SPARKS                   -25.23 -12.27 -19.49                   -37.12 -16.83 -27.25 Zhou−SPARKS 157
158 dill_ucsf                   -25.23 -12.27 -19.49                   -37.12 -16.83 -27.25 dill_ucsf 158
159 dill_ucsf_extended                   -25.23 -12.27 -19.49                   -37.12 -16.83 -27.25 dill_ucsf_extended 159
160 huber−torda−server                   -25.23 -12.27 -19.49                   -37.12 -16.83 -27.25 huber−torda−server 160
161 igor                   -25.23 -12.27 -19.49                   -37.12 -16.83 -27.25 igor 161
162 jacobson                   -25.23 -12.27 -19.49                   -37.12 -16.83 -27.25 jacobson 162
163 mumssp                   -25.23 -12.27 -19.49                   -37.12 -16.83 -27.25 mumssp 163
164 rivilo                   -25.23 -12.27 -19.49                   -37.12 -16.83 -27.25 rivilo 164
165 taylor                   -25.23 -12.27 -19.49                   -37.12 -16.83 -27.25 taylor 165
166 test_http_server_01                   -25.23 -12.27 -19.49                   -37.12 -16.83 -27.25 test_http_server_01 166