T0390
ephrin A1 Homo sapiens
Target sequence:
>T0390 EFNA1A, Homo sapiens, 182 residues
AAPEHHHHHHDYDIPTTENLYFQGAMDAADRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHVNPQEKRLAADDP
Structure:
Determined by:
SGC
PDB ID: 3czu

Ribbon diagram of 390: 3czu chain B
Domains: PyMOL of domains
Single domain protein.
Structure classification:
Cupredoxin-like fold. Lacks the metal-binding site of cupredoxins, but is homologous to them.

Cartoon diagram of 390: chain B
CASP category:
Comparative modeling:easy.
Closest templates:
Target sequence - PDB file inconsistencies:
28 N-terminal residues 1-AAPEHHHHHHDYDIPTTENLYFQGAMDA-28, 2 internal residues 67-DH-68 and 23 C-terminal residues 161-KITHSPQAHVNPQEKRLAADDP-182 of the target sequence are missing from PDB coordinates. Residue 18 in PDB corresponds to residue 29 in the target sequence.
T0390 3czu.pdb T0390.pdb PyMOL PyMOL of domains
T0390 1 AAPEHHHHHHDYDIPTTENLYFQGAMDAADRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHVNPQEKRLAADDP 182 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~||||||||||||||||||||||||||||||||||||||~~||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~~~~~~~~~~~~~~~~ 3czuA 18 ----------------------------ADRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYE--SVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSG---------------------- 149
Single domain protein: target 29-66, 69-160 ; pdb 18-55, 58-149
Sequence classification:
Eprin family (PF00812) in Pfam.
Server predictions:
T0390:pdb 18-149:seq 29-160:CM_easy;   alignment

First models for T0390:
Gaussian kernel density estimation
for GDT-TS scores of the
first server models, plotted at various bandwidths (=standard deviations).
The GDT-TS scores are shown as a spectrum along
the horizontal axis: each bar represents first server model. The bars are
colored
green, gray and black for top 10, bottom 25% and the rest of servers.
The family of curves with varying
bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units
with a step of 0.1, which corresponds to the
color ramp from magenta through blue to cyan. Thicker curves: red,
yellow-framed brown and black, correspond to bandwidths 1, 2 and 4
respectively.
click on a score in the table below to display the model in PyMOL
| # | GROUP ↓ | TS ↓ | TR ↓ | CS ↓ | TS ↓ | TR ↓ | CS ↓ | TS ↓ | TR ↓ | CS ↓ | TS ↓ | TR ↓ | CS ↓ | ↓ GROUP | # |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| T0390 | T0390 | T0390 | T0390 | ||||||||||||
| First score | First Z-score | Best score | Best Z-score | ||||||||||||
| 1 | MULTICOM−REFINE | 89.61 | 87.56 | 90.82 | 0.74 | 0.92 | 0.56 | 89.61 | 87.56 | 91.30 | 0.65 | 0.82 | 0.52 | MULTICOM−REFINE | 1 |
| 2 | MULTICOM−CLUSTER | 89.61 | 87.31 | 91.07 | 0.74 | 0.88 | 0.58 | 89.61 | 87.31 | 91.07 | 0.65 | 0.78 | 0.49 | MULTICOM−CLUSTER | 2 |
| 3 | MUSTER | 89.61 | 84.42 | 90.75 | 0.74 | 0.43 | 0.55 | 89.61 | 86.22 | 91.28 | 0.65 | 0.57 | 0.51 | MUSTER | 3 |
| 4 | nFOLD3 | 89.42 | 86.86 | 90.76 | 0.70 | 0.81 | 0.55 | 89.42 | 86.86 | 90.76 | 0.61 | 0.69 | 0.45 | nFOLD3 | 4 |
| 5 | MULTICOM−CMFR | 89.42 | 86.73 | 90.71 | 0.70 | 0.79 | 0.55 | 89.81 | 86.73 | 91.70 | 0.69 | 0.67 | 0.57 | MULTICOM−CMFR | 5 |
| 6 | Pcons_local | 89.23 | 86.54 | 90.70 | 0.67 | 0.76 | 0.54 | 89.23 | 86.54 | 90.70 | 0.57 | 0.63 | 0.44 | Pcons_local | 6 |
| 7 | Pcons_dot_net | 89.23 | 86.54 | 90.70 | 0.67 | 0.76 | 0.54 | 89.23 | 86.80 | 90.70 | 0.57 | 0.68 | 0.44 | Pcons_dot_net | 7 |
| 8 | Pcons_multi | 89.23 | 86.54 | 90.70 | 0.67 | 0.76 | 0.54 | 89.61 | 87.18 | 91.34 | 0.65 | 0.75 | 0.52 | Pcons_multi | 8 |
| 9 | MUProt | 89.04 | 86.86 | 90.99 | 0.64 | 0.81 | 0.57 | 90.00 | 88.20 | 91.63 | 0.73 | 0.95 | 0.56 | MUProt | 9 |
| 10 | PS2−server | 89.04 | 86.60 | 90.89 | 0.64 | 0.77 | 0.56 | 89.04 | 86.60 | 90.89 | 0.53 | 0.64 | 0.46 | PS2−server | 10 |
| 11 | 3DShot2 | 89.04 | 86.22 | 90.76 | 0.64 | 0.71 | 0.55 | 89.04 | 86.22 | 90.76 | 0.53 | 0.57 | 0.45 | 3DShot2 | 11 |
| 12 | BAKER−ROBETTA | 88.85 | 86.67 | 90.76 | 0.61 | 0.78 | 0.55 | 89.23 | 87.44 | 90.76 | 0.57 | 0.80 | 0.45 | BAKER−ROBETTA | 12 |
| 13 | PSI | 88.85 | 86.41 | 90.75 | 0.61 | 0.74 | 0.55 | 88.85 | 86.41 | 90.75 | 0.49 | 0.60 | 0.44 | PSI | 13 |
| 14 | GeneSilicoMetaServer | 88.85 | 84.36 | 90.52 | 0.61 | 0.42 | 0.53 | 88.85 | 85.39 | 90.52 | 0.49 | 0.41 | 0.41 | GeneSilicoMetaServer | 14 |
| 15 | FOLDpro | 88.65 | 86.47 | 91.37 | 0.58 | 0.75 | 0.61 | 88.65 | 86.47 | 91.37 | 0.45 | 0.62 | 0.53 | FOLDpro | 15 |
| 16 | keasar−server | 88.65 | 84.94 | 90.72 | 0.58 | 0.51 | 0.55 | 88.85 | 85.39 | 90.72 | 0.49 | 0.41 | 0.44 | keasar−server | 16 |
| 17 | HHpred2 | 88.46 | 86.15 | 90.66 | 0.55 | 0.70 | 0.54 | 88.46 | 86.15 | 90.66 | 0.41 | 0.56 | 0.43 | HHpred2 | 17 |
| 18 | FAMSD | 88.46 | 85.64 | 90.04 | 0.55 | 0.62 | 0.48 | 88.46 | 85.64 | 90.04 | 0.41 | 0.46 | 0.35 | FAMSD | 18 |
| 19 | pro−sp3−TASSER | 88.27 | 85.58 | 89.59 | 0.51 | 0.61 | 0.43 | 88.27 | 85.58 | 89.59 | 0.37 | 0.45 | 0.29 | pro−sp3−TASSER | 19 |
| 20 | RAPTOR | 88.27 | 85.58 | 90.67 | 0.51 | 0.61 | 0.54 | 88.27 | 85.58 | 90.67 | 0.37 | 0.45 | 0.43 | RAPTOR | 20 |
| 21 | LEE−SERVER | 88.27 | 84.94 | 90.41 | 0.51 | 0.51 | 0.51 | 89.23 | 87.05 | 91.57 | 0.57 | 0.73 | 0.55 | LEE−SERVER | 21 |
| 22 | MULTICOM−RANK | 88.08 | 85.51 | 90.70 | 0.48 | 0.60 | 0.54 | 89.23 | 85.51 | 91.55 | 0.57 | 0.43 | 0.55 | MULTICOM−RANK | 22 |
| 23 | Zhang−Server | 88.08 | 85.00 | 90.54 | 0.48 | 0.52 | 0.53 | 88.85 | 85.64 | 90.69 | 0.49 | 0.46 | 0.44 | Zhang−Server | 23 |
| 24 | fais−server | 88.08 | 84.74 | 90.74 | 0.48 | 0.48 | 0.55 | 89.04 | 87.11 | 90.74 | 0.53 | 0.74 | 0.44 | fais−server | 24 |
| 25 | circle | 88.08 | 84.74 | 89.72 | 0.48 | 0.48 | 0.44 | 88.08 | 85.51 | 89.77 | 0.33 | 0.43 | 0.32 | circle | 25 |
| 26 | FFASflextemplate | 88.08 | 84.23 | 90.68 | 0.48 | 0.40 | 0.54 | 88.08 | 84.23 | 90.68 | 0.33 | 0.19 | 0.44 | FFASflextemplate | 26 |
| 27 | FFASsuboptimal | 88.08 | 82.44 | 89.09 | 0.48 | 0.12 | 0.38 | 89.61 | 87.82 | 91.04 | 0.65 | 0.87 | 0.48 | FFASsuboptimal | 27 |
| 28 | 3Dpro | 87.89 | 85.32 | 91.32 | 0.45 | 0.57 | 0.61 | 88.65 | 86.47 | 91.37 | 0.45 | 0.62 | 0.53 | 3Dpro | 28 |
| 29 | mGenTHREADER | 87.89 | 84.42 | 89.55 | 0.45 | 0.43 | 0.43 | 87.89 | 84.42 | 89.55 | 0.29 | 0.22 | 0.29 | mGenTHREADER | 29 |
| 30 | GS−KudlatyPred | 87.69 | 85.13 | 90.75 | 0.42 | 0.54 | 0.55 | 87.69 | 85.13 | 90.75 | 0.25 | 0.36 | 0.44 | GS−KudlatyPred | 30 |
| 31 | FFASstandard | 87.69 | 83.20 | 90.68 | 0.42 | 0.24 | 0.54 | 88.08 | 84.23 | 90.68 | 0.33 | 0.19 | 0.44 | FFASstandard | 31 |
| 32 | Frankenstein | 87.69 | 81.92 | 89.22 | 0.42 | 0.04 | 0.39 | 87.69 | 81.92 | 89.22 | 0.25 | 0.25 | Frankenstein | 32 | |
| 33 | Poing | 87.50 | 83.40 | 90.91 | 0.39 | 0.27 | 0.57 | 87.50 | 83.40 | 90.91 | 0.21 | 0.03 | 0.47 | Poing | 33 |
| 34 | Phyre2 | 87.50 | 83.40 | 90.91 | 0.39 | 0.27 | 0.57 | 87.50 | 83.40 | 90.91 | 0.21 | 0.03 | 0.47 | Phyre2 | 34 |
| 35 | Phyre_de_novo | 87.50 | 83.40 | 90.91 | 0.39 | 0.27 | 0.57 | 87.50 | 83.40 | 90.91 | 0.21 | 0.03 | 0.47 | Phyre_de_novo | 35 |
| 36 | Phragment | 87.50 | 83.40 | 90.91 | 0.39 | 0.27 | 0.57 | 87.50 | 83.40 | 90.91 | 0.21 | 0.03 | 0.47 | Phragment | 36 |
| 37 | Pushchino | 87.31 | 85.26 | 88.34 | 0.36 | 0.56 | 0.30 | 87.31 | 85.26 | 88.34 | 0.17 | 0.39 | 0.13 | Pushchino | 37 |
| 38 | BioSerf | 87.11 | 83.40 | 89.79 | 0.32 | 0.27 | 0.45 | 87.11 | 83.40 | 89.79 | 0.13 | 0.03 | 0.32 | BioSerf | 38 |
| 39 | pipe_int | 87.11 | 83.14 | 89.83 | 0.32 | 0.23 | 0.45 | 87.31 | 83.14 | 90.51 | 0.17 | 0.41 | pipe_int | 39 | |
| 40 | GS−MetaServer2 | 86.92 | 83.97 | 90.02 | 0.29 | 0.36 | 0.47 | 86.92 | 83.97 | 90.02 | 0.09 | 0.14 | 0.35 | GS−MetaServer2 | 40 |
| 41 | HHpred4 | 86.73 | 82.24 | 89.82 | 0.26 | 0.09 | 0.45 | 86.73 | 82.24 | 89.82 | 0.05 | 0.32 | HHpred4 | 41 | |
| 42 | HHpred5 | 86.73 | 82.24 | 89.82 | 0.26 | 0.09 | 0.45 | 86.73 | 82.24 | 89.82 | 0.05 | 0.32 | HHpred5 | 42 | |
| 43 | Fiser−M4T | 86.54 | 82.56 | 88.95 | 0.23 | 0.14 | 0.36 | 86.54 | 82.56 | 88.95 | 0.01 | 0.21 | Fiser−M4T | 43 | |
| 44 | SAM−T08−server | 86.15 | 83.46 | 88.12 | 0.17 | 0.28 | 0.28 | 87.31 | 83.46 | 89.16 | 0.17 | 0.04 | 0.24 | SAM−T08−server | 44 |
| 45 | panther_server | 85.96 | 83.01 | 86.35 | 0.13 | 0.21 | 0.09 | 85.96 | 83.01 | 86.35 | panther_server | 45 | |||
| 46 | YASARA | 85.96 | 82.89 | 89.13 | 0.13 | 0.19 | 0.38 | 86.15 | 83.97 | 89.13 | 0.14 | 0.23 | YASARA | 46 | |
| 47 | forecast | 85.77 | 81.15 | 87.74 | 0.10 | 0.24 | 85.77 | 81.15 | 87.74 | 0.05 | forecast | 47 | |||
| 48 | CpHModels | 85.39 | 82.31 | 84.55 | 0.04 | 0.10 | 85.39 | 82.31 | 84.55 | CpHModels | 48 | ||||
| 49 | 3D−JIGSAW_V3 | 84.81 | 81.60 | 84.83 | 87.89 | 85.19 | 90.48 | 0.29 | 0.37 | 0.41 | 3D−JIGSAW_V3 | 49 | |||
| 50 | SAM−T02−server | 84.23 | 80.13 | 80.64 | 84.23 | 80.13 | 80.64 | SAM−T02−server | 50 | ||||||
| 51 | SAM−T06−server | 82.50 | 78.78 | 83.75 | 82.50 | 79.68 | 83.75 | SAM−T06−server | 51 | ||||||
| 52 | METATASSER | 82.50 | 74.87 | 81.19 | 84.04 | 81.03 | 83.29 | METATASSER | 52 | ||||||
| 53 | huber−torda−server | 82.31 | 78.97 | 80.62 | 82.31 | 78.97 | 80.62 | huber−torda−server | 53 | ||||||
| 54 | COMA | 81.92 | 76.54 | 77.76 | 81.92 | 76.54 | 77.76 | COMA | 54 | ||||||
| 55 | Distill | 80.00 | 74.74 | 73.53 | 81.15 | 74.74 | 76.26 | Distill | 55 | ||||||
| 56 | COMA−M | 79.23 | 76.80 | 73.06 | 79.23 | 76.80 | 73.06 | COMA−M | 56 | ||||||
| 57 | ACOMPMOD | 72.50 | 68.14 | 63.11 | 72.50 | 68.14 | 63.11 | ACOMPMOD | 57 | ||||||
| 58 | FALCON_CONSENSUS | 71.73 | 69.55 | 60.88 | 88.85 | 86.41 | 90.75 | 0.49 | 0.60 | 0.44 | FALCON_CONSENSUS | 58 | |||
| 59 | FALCON | 71.73 | 69.55 | 60.88 | 88.85 | 86.41 | 90.75 | 0.49 | 0.60 | 0.44 | FALCON | 59 | |||
| 60 | FUGUE_KM | 71.54 | 69.36 | 60.51 | 71.54 | 69.36 | 60.51 | FUGUE_KM | 60 | ||||||
| 61 | 3D−JIGSAW_AEP | 70.58 | 66.35 | 62.99 | 87.11 | 83.40 | 89.92 | 0.13 | 0.03 | 0.34 | 3D−JIGSAW_AEP | 61 | |||
| 62 | FEIG | 69.42 | 63.65 | 71.85 | 85.00 | 81.03 | 81.18 | FEIG | 62 | ||||||
| 63 | rehtnap | 60.58 | 55.96 | 49.65 | 60.77 | 55.96 | 50.16 | rehtnap | 63 | ||||||
| 64 | mariner1 | 35.00 | 25.58 | 36.28 | 49.42 | 38.78 | 51.96 | mariner1 | 64 | ||||||
| 65 | MUFOLD−MD | 20.77 | 19.49 | 25.97 | 20.77 | 19.49 | 25.97 | MUFOLD−MD | 65 | ||||||
| 66 | MUFOLD−Server | 19.04 | 16.80 | 18.18 | 19.04 | 16.80 | 18.19 | MUFOLD−Server | 66 | ||||||
| 67 | RBO−Proteus | 17.69 | 15.83 | 21.56 | 18.85 | 17.69 | 25.44 | RBO−Proteus | 67 | ||||||
| 68 | RANDOM | 15.07 | 12.36 | 15.07 | 15.07 | 12.36 | 15.07 | RANDOM | 68 | ||||||
| 69 | schenk−torda−server | 12.69 | 12.12 | 14.72 | 15.58 | 13.21 | 14.90 | schenk−torda−server | 69 | ||||||
| 70 | OLGAFS | 12.12 | 10.00 | 9.07 | 12.50 | 10.26 | 11.30 | OLGAFS | 70 | ||||||
| 71 | mahmood−torda−server | 11.35 | 9.55 | 16.40 | 12.88 | 11.35 | 17.63 | mahmood−torda−server | 71 | ||||||
| 72 | BHAGEERATH | BHAGEERATH | 72 | ||||||||||||
| 73 | LOOPP_Server | LOOPP_Server | 73 | ||||||||||||
| 74 | test_http_server_01 | test_http_server_01 | 74 | ||||||||||||