T0491
primosomal replication protein N from Bordetella pertussis
Target sequence:
>T0491 Primosomal replication protein, Bordetella pertussis, 115 residues
MNTLELSARVLECGAMRHTPAGLPALELLLVHESEVVEAGHPRRVELTISAVALGDLALLLADTPLGTEMQVQGFLAPARKDSVKVKLHLQQARRIAGSMGRDPLVGLEHHHHHH
Structure:
Determined by:
NESG
PDB ID: 3dm4

Cartoon diagram of 491: 3dm4
Domains: PyMOL of domains
Single domain protein. Despite claimed 2Å, it looks like a poorly refined structure with R factor exceeding Rfree.
Structure classification:
CASP category:
Comparative modeling:easy.
Closest templates:
Target sequence - PDB file inconsistencies:
T0491 3dm4.pdb T0491.pdb PyMOL PyMOL of domains
T0491 1 MNTLELSARVLECGAMRHTPAGLPALELLLVHESEVVEAGHPRRVELTISAVALGDLALLLADTPLGTEMQVQGFLAPARKDSVKVKLHLQQARRIAGSMGRDPLVGLEHHHHHH 115 ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~~~~~~~~~~~ 3dm4A 1 MNTLELSARVLECGAMRHTPAGLPALELLLVHESEVVEAGHPRRVELTISAVALGDLALLLADTPLGTEMQVQGFLAPARKDSVKVKLHLQQARRIAG----------------- 98
Residue change log: change 1, 16, 70, MSE to MET;
Single domain protein: target 1-98 ; pdb 1-98
Sequence classification:
OB-fold nucleic acid binding domain (tRNA_anti) in Pfam.
Server predictions:
T0491:pdb 1-98:seq 1-98:CM_easy;   alignment

First models for T0491:
Gaussian kernel density estimation
for GDT-TS scores of the
first server models, plotted at various bandwidths (=standard deviations).
The GDT-TS scores are shown as a spectrum along
the horizontal axis: each bar represents first server model. The bars are
colored
green, gray and black for top 10, bottom 25% and the rest of servers.
The family of curves with varying
bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units
with a step of 0.1, which corresponds to the
color ramp from magenta through blue to cyan. Thicker curves: red,
yellow-framed brown and black, correspond to bandwidths 1, 2 and 4
respectively.
click on a score in the table below to display the model in PyMOL
| # | GROUP ↓ | TS ↓ | TR ↓ | CS ↓ | TS ↓ | TR ↓ | CS ↓ | TS ↓ | TR ↓ | CS ↓ | TS ↓ | TR ↓ | CS ↓ | ↓ GROUP | # |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| T0491 | T0491 | T0491 | T0491 | ||||||||||||
| First score | First Z-score | Best score | Best Z-score | ||||||||||||
| 1 | keasar−server | 87.50 | 81.21 | 81.49 | 1.24 | 1.31 | 0.27 | 87.50 | 81.97 | 88.36 | 1.41 | 1.39 | 1.16 | keasar−server | 1 |
| 2 | YASARA | 86.73 | 77.38 | 86.20 | 1.14 | 0.83 | 0.88 | 86.99 | 77.38 | 86.20 | 1.29 | 0.45 | 0.71 | YASARA | 2 |
| 3 | circle | 86.48 | 76.28 | 82.04 | 1.10 | 0.69 | 0.34 | 86.48 | 81.21 | 84.14 | 1.17 | 1.23 | 0.27 | circle | 3 |
| 4 | 3DShot2 | 86.22 | 80.78 | 86.88 | 1.07 | 1.25 | 0.97 | 86.22 | 80.78 | 86.88 | 1.11 | 1.14 | 0.85 | 3DShot2 | 4 |
| 5 | mGenTHREADER | 85.46 | 81.04 | 79.18 | 0.97 | 1.29 | 85.46 | 81.04 | 79.18 | 0.93 | 1.20 | mGenTHREADER | 5 | ||
| 6 | SAM−T02−server | 84.95 | 80.19 | 80.14 | 0.90 | 1.18 | 0.09 | 84.95 | 80.53 | 81.61 | 0.81 | 1.09 | SAM−T02−server | 6 | |
| 7 | LEE−SERVER | 84.95 | 79.34 | 82.51 | 0.90 | 1.07 | 0.40 | 89.54 | 81.55 | 90.55 | 1.89 | 1.30 | 1.62 | LEE−SERVER | 7 |
| 8 | SAM−T08−server | 84.69 | 78.06 | 89.68 | 0.87 | 0.91 | 1.33 | 84.69 | 80.44 | 89.68 | 0.75 | 1.07 | 1.44 | SAM−T08−server | 8 |
| 9 | BioSerf | 84.69 | 74.15 | 90.26 | 0.87 | 0.42 | 1.40 | 84.69 | 74.15 | 90.26 | 0.75 | 1.56 | BioSerf | 9 | |
| 10 | PSI | 84.44 | 77.98 | 82.09 | 0.83 | 0.90 | 0.35 | 84.44 | 77.98 | 84.22 | 0.69 | 0.57 | 0.29 | PSI | 10 |
| 11 | HHpred5 | 83.93 | 78.83 | 83.89 | 0.77 | 1.01 | 0.58 | 83.93 | 78.83 | 83.89 | 0.57 | 0.75 | 0.22 | HHpred5 | 11 |
| 12 | MUFOLD−Server | 83.67 | 77.21 | 81.84 | 0.73 | 0.80 | 0.31 | 85.20 | 81.12 | 81.84 | 0.87 | 1.21 | MUFOLD−Server | 12 | |
| 13 | COMA | 82.91 | 78.15 | 81.72 | 0.63 | 0.92 | 0.30 | 82.91 | 78.15 | 83.67 | 0.33 | 0.61 | 0.17 | COMA | 13 |
| 14 | FFASstandard | 82.65 | 79.08 | 81.82 | 0.60 | 1.04 | 0.31 | 84.18 | 79.08 | 82.28 | 0.63 | 0.80 | FFASstandard | 14 | |
| 15 | FFASflextemplate | 82.65 | 79.08 | 81.82 | 0.60 | 1.04 | 0.31 | 84.44 | 80.70 | 81.82 | 0.69 | 1.13 | FFASflextemplate | 15 | |
| 16 | MULTICOM−CMFR | 81.89 | 76.62 | 83.93 | 0.49 | 0.73 | 0.58 | 82.91 | 79.34 | 84.23 | 0.33 | 0.85 | 0.29 | MULTICOM−CMFR | 16 |
| 17 | Phyre_de_novo | 81.89 | 74.75 | 85.13 | 0.49 | 0.49 | 0.74 | 81.89 | 74.75 | 85.13 | 0.09 | 0.48 | Phyre_de_novo | 17 | |
| 18 | Zhang−Server | 81.63 | 75.68 | 84.96 | 0.46 | 0.61 | 0.72 | 83.93 | 79.68 | 86.71 | 0.57 | 0.92 | 0.81 | Zhang−Server | 18 |
| 19 | PS2−server | 81.63 | 74.32 | 82.55 | 0.46 | 0.44 | 0.41 | 82.65 | 74.32 | 89.34 | 0.27 | 1.37 | PS2−server | 19 | |
| 20 | RAPTOR | 81.63 | 73.30 | 83.13 | 0.46 | 0.31 | 0.48 | 81.63 | 73.30 | 83.14 | 0.03 | 0.06 | RAPTOR | 20 | |
| 21 | MULTICOM−CLUSTER | 81.38 | 73.89 | 83.48 | 0.43 | 0.39 | 0.53 | 83.16 | 77.72 | 84.38 | 0.39 | 0.52 | 0.32 | MULTICOM−CLUSTER | 21 |
| 22 | fais−server | 81.12 | 72.28 | 82.61 | 0.39 | 0.18 | 0.41 | 81.12 | 73.47 | 87.41 | 0.96 | fais−server | 22 | ||
| 23 | HHpred2 | 81.12 | 67.86 | 83.39 | 0.39 | 0.51 | 81.12 | 67.86 | 83.39 | 0.11 | HHpred2 | 23 | |||
| 24 | FFASsuboptimal | 80.87 | 76.79 | 80.72 | 0.36 | 0.75 | 0.17 | 83.67 | 79.76 | 81.90 | 0.51 | 0.94 | FFASsuboptimal | 24 | |
| 25 | Frankenstein | 80.87 | 76.79 | 83.44 | 0.36 | 0.75 | 0.52 | 85.97 | 80.02 | 83.44 | 1.05 | 0.99 | 0.13 | Frankenstein | 25 |
| 26 | 3D−JIGSAW_V3 | 80.87 | 76.28 | 83.82 | 0.36 | 0.69 | 0.57 | 80.87 | 76.28 | 85.84 | 0.23 | 0.63 | 3D−JIGSAW_V3 | 26 | |
| 27 | nFOLD3 | 80.87 | 75.77 | 82.57 | 0.36 | 0.62 | 0.41 | 80.87 | 75.77 | 82.57 | 0.13 | nFOLD3 | 27 | ||
| 28 | Pcons_dot_net | 80.87 | 68.11 | 81.97 | 0.36 | 0.33 | 82.14 | 77.64 | 84.28 | 0.15 | 0.51 | 0.30 | Pcons_dot_net | 28 | |
| 29 | Pcons_multi | 80.87 | 68.11 | 81.97 | 0.36 | 0.33 | 80.87 | 73.38 | 83.67 | 0.17 | Pcons_multi | 29 | |||
| 30 | ACOMPMOD | 80.61 | 75.34 | 82.24 | 0.32 | 0.57 | 0.37 | 80.61 | 75.34 | 82.24 | 0.04 | ACOMPMOD | 30 | ||
| 31 | LOOPP_Server | 80.61 | 74.83 | 80.86 | 0.32 | 0.50 | 0.19 | 84.18 | 75.51 | 84.01 | 0.63 | 0.07 | 0.25 | LOOPP_Server | 31 |
| 32 | METATASSER | 80.61 | 69.73 | 80.54 | 0.32 | 0.15 | 80.61 | 74.32 | 84.94 | 0.44 | METATASSER | 32 | |||
| 33 | pro−sp3−TASSER | 80.36 | 73.72 | 82.02 | 0.29 | 0.36 | 0.34 | 80.36 | 73.72 | 83.87 | 0.22 | pro−sp3−TASSER | 33 | ||
| 34 | GS−MetaServer2 | 80.36 | 72.36 | 82.85 | 0.29 | 0.19 | 0.44 | 84.69 | 74.32 | 87.09 | 0.75 | 0.89 | GS−MetaServer2 | 34 | |
| 35 | GeneSilicoMetaServer | 80.36 | 72.36 | 82.85 | 0.29 | 0.19 | 0.44 | 84.69 | 79.34 | 82.85 | 0.75 | 0.85 | 0.00 | GeneSilicoMetaServer | 35 |
| 36 | HHpred4 | 80.10 | 72.28 | 82.66 | 0.26 | 0.18 | 0.42 | 80.10 | 72.28 | 82.66 | HHpred4 | 36 | |||
| 37 | Pushchino | 79.85 | 73.55 | 82.38 | 0.22 | 0.34 | 0.38 | 79.85 | 73.55 | 82.38 | Pushchino | 37 | |||
| 38 | GS−KudlatyPred | 79.85 | 73.55 | 82.95 | 0.22 | 0.34 | 0.46 | 79.85 | 73.55 | 86.02 | 0.67 | GS−KudlatyPred | 38 | ||
| 39 | 3Dpro | 79.85 | 70.66 | 83.83 | 0.22 | 0.57 | 79.85 | 70.66 | 83.83 | 0.21 | 3Dpro | 39 | |||
| 40 | FALCON | 79.85 | 70.66 | 80.96 | 0.22 | 0.20 | 79.85 | 71.51 | 81.80 | FALCON | 40 | ||||
| 41 | MULTICOM−REFINE | 79.59 | 74.66 | 83.45 | 0.19 | 0.48 | 0.52 | 83.67 | 78.06 | 83.99 | 0.51 | 0.59 | 0.24 | MULTICOM−REFINE | 41 |
| 42 | FUGUE_KM | 79.59 | 71.60 | 81.27 | 0.19 | 0.10 | 0.24 | 79.59 | 71.60 | 81.27 | FUGUE_KM | 42 | |||
| 43 | MUProt | 78.57 | 73.64 | 83.67 | 0.05 | 0.35 | 0.55 | 83.67 | 78.49 | 84.02 | 0.51 | 0.68 | 0.25 | MUProt | 43 |
| 44 | Poing | 78.57 | 70.41 | 80.75 | 0.05 | 0.17 | 84.95 | 79.51 | 89.32 | 0.81 | 0.89 | 1.36 | Poing | 44 | |
| 45 | Phyre2 | 78.57 | 70.41 | 80.75 | 0.05 | 0.17 | 84.44 | 79.00 | 89.39 | 0.69 | 0.78 | 1.38 | Phyre2 | 45 | |
| 46 | Phragment | 78.57 | 70.41 | 80.75 | 0.05 | 0.17 | 84.18 | 78.74 | 89.33 | 0.63 | 0.73 | 1.37 | Phragment | 46 | |
| 47 | MUSTER | 78.57 | 66.33 | 84.57 | 0.05 | 0.67 | 82.91 | 76.28 | 84.57 | 0.33 | 0.23 | 0.36 | MUSTER | 47 | |
| 48 | MUFOLD−MD | 78.32 | 65.22 | 73.78 | 0.02 | 78.32 | 65.22 | 73.78 | MUFOLD−MD | 48 | |||||
| 49 | SAM−T06−server | 78.06 | 66.50 | 84.17 | 0.61 | 83.67 | 76.70 | 84.17 | 0.51 | 0.31 | 0.28 | SAM−T06−server | 49 | ||
| 50 | Fiser−M4T | 77.81 | 72.36 | 79.62 | 0.19 | 0.03 | 77.81 | 72.36 | 79.62 | Fiser−M4T | 50 | ||||
| 51 | 3D−JIGSAW_AEP | 77.55 | 63.44 | 82.09 | 0.35 | 77.55 | 66.58 | 82.75 | 3D−JIGSAW_AEP | 51 | |||||
| 52 | CpHModels | 77.30 | 72.36 | 73.68 | 0.19 | 77.30 | 72.36 | 73.68 | CpHModels | 52 | |||||
| 53 | MULTICOM−RANK | 76.53 | 73.81 | 83.07 | 0.38 | 0.47 | 82.40 | 76.11 | 85.48 | 0.21 | 0.19 | 0.56 | MULTICOM−RANK | 53 | |
| 54 | COMA−M | 75.51 | 68.54 | 81.84 | 0.31 | 77.30 | 70.15 | 83.67 | 0.17 | COMA−M | 54 | ||||
| 55 | FAMSD | 75.25 | 65.05 | 84.02 | 0.60 | 86.48 | 81.46 | 84.02 | 1.17 | 1.28 | 0.25 | FAMSD | 55 | ||
| 56 | BAKER−ROBETTA | 67.86 | 55.61 | 61.93 | 71.68 | 67.60 | 74.06 | BAKER−ROBETTA | 56 | ||||||
| 57 | Pcons_local | 66.58 | 61.82 | 58.16 | 79.59 | 76.87 | 81.22 | 0.35 | Pcons_local | 57 | |||||
| 58 | pipe_int | 65.82 | 58.67 | 66.24 | 65.82 | 58.67 | 66.24 | pipe_int | 58 | ||||||
| 59 | panther_server | 64.54 | 59.61 | 66.38 | 83.93 | 80.02 | 79.33 | 0.57 | 0.99 | panther_server | 59 | ||||
| 60 | FEIG | 59.69 | 53.91 | 59.70 | 75.25 | 69.13 | 78.30 | FEIG | 60 | ||||||
| 61 | RBO−Proteus | 59.44 | 50.94 | 70.78 | 59.44 | 52.98 | 70.78 | RBO−Proteus | 61 | ||||||
| 62 | FOLDpro | 58.16 | 53.74 | 60.65 | 68.11 | 61.65 | 67.66 | FOLDpro | 62 | ||||||
| 63 | rehtnap | 55.10 | 48.81 | 49.77 | 66.33 | 61.40 | 50.58 | rehtnap | 63 | ||||||
| 64 | FALCON_CONSENSUS | 54.59 | 47.11 | 56.56 | 79.08 | 70.92 | 79.85 | FALCON_CONSENSUS | 64 | ||||||
| 65 | forecast | 54.34 | 41.24 | 49.11 | 75.00 | 67.52 | 81.62 | forecast | 65 | ||||||
| 66 | mariner1 | 52.55 | 43.88 | 56.11 | 56.12 | 53.06 | 58.71 | mariner1 | 66 | ||||||
| 67 | Distill | 19.39 | 19.39 | 24.43 | 20.92 | 19.39 | 27.94 | Distill | 67 | ||||||
| 68 | RANDOM | 18.92 | 15.66 | 18.92 | 18.92 | 15.66 | 18.92 | RANDOM | 68 | ||||||
| 69 | schenk−torda−server | 16.84 | 13.95 | 15.28 | 16.84 | 14.80 | 16.02 | schenk−torda−server | 69 | ||||||
| 70 | mahmood−torda−server | 15.05 | 12.33 | 19.20 | 19.13 | 16.24 | 24.85 | mahmood−torda−server | 70 | ||||||
| 71 | OLGAFS | 13.27 | 11.22 | 8.27 | 71.68 | 66.58 | 58.12 | OLGAFS | 71 | ||||||
| 72 | huber−torda−server | 0.00 | 0.00 | 0.00 | 0.00 | huber−torda−server | 72 | ||||||||
| 73 | BHAGEERATH | BHAGEERATH | 73 | ||||||||||||
| 74 | test_http_server_01 | test_http_server_01 | 74 | ||||||||||||