T0486

Targets
387 388 389 390
391 392 393 394
395 396 397 398
399 400 401 402
403 404 405 406
407 408 409 410
411 412 413 414
415 416 417 418
419 420 421 422
423 424 425 426
427 428 429 430
431 432 433 434
435 436 437 438
439 440 441 442
443 444 445 446
447 448 449 450
451 452 453 454
455 456 457 458
459 460 461 462
463 464 465 466
467 468 469 470
471 472 473 474
475 476 477 478
479 480 481 482
483 484 485 486
487 488 489 490
491 492 493 494
495 496 497 498
499 500 501 502
503 504 505 506
507 508 509 510
511 512 513 514

T0486

Enoyl coenzyme A hydratase domain – containing protein 3 (Echdc3) from Homo sapiens

Target type: Server only

Target sequence:

>T0486 ECHDC3A , Homo sapiens, 287 residues
MHHHHHHSSGVDLGTENLYFQSMGAGRRESEPRPTSARQLDGIRNIVLSNPKKRNTLSLAMLKSLQSDILHDADSNDLKVIIISAEGPVFSSGHDLKELTEEQGRDYHAEVFQTCSKVMMHIRNHPVPVIAMVNGLATAAGCQLVASCDIAVASDKSSFATPGVNVGLFCSTPGVALARAVPRKVALEMLFTGEPISAQEALLHGLLSKVVPEAELQEETMRIARKIASLSRPVVSLGKATFYKQLPQDLGTAYYLTSQAMVDNLALRDGQEGITAFLQKRKPVWSH

Structure:
Method: X-ray, res=2.3Å, R/Rfree=0.17/0.22
Determined by: SGC
PDB ID: 2vx2

2vx2_A cartoon
Cartoon diagram of 486: 2vx2 chain A

PyMOL of 2vx2

Domains:  PyMOL of domains

Two domains. Residue ranges in PDB: 45-243 and 244-300. Residue ranges in target: 32-230 and 231-287

486 domain evaluation plot
Correlation between weighted by the number of residues sum of GDT-TS scores for domain-based evlatuation (y, vertical axis) and whole chain GDT-TS (x, horizontal axis).

To compute the weighted sum, GDT-TS for each domain was multiplied by the domain length, and this sum was divided by the sum of domain lengths. Each point represents first server model. Green, gray and black points are top 10, bottom 25% and the rest of prediction models. Blue line is the best-fit slope line (intersection 0) to the top 10 server models. Red line is the diagonal. Slope and root mean square y-x distance for the top 10 models (average difference between the weighted sum of domain GDT-TS scores and the whole chain GDT-TS score) are shown above the plot.

Structure classification:

ClpP/crotonase fold, with a C-terminal coiled-coil trimerization domain.

CASP category:

Whole chain: Comparative modeling:easy.

1st domain: Comparative modeling:easy. 2nd domain: Comparative modeling:easy.

Closest templates:

2ppy, 1nzy, 2ej5, 1dci, 1uiy.

Target sequence - PDB file inconsistencies:

T0486    2vx2.pdb    T0486.pdb    PyMOL    PyMOL of domains    

T0486    1 MHHHHHHSSGVDLGTENLYFQSMGAGRRESEPRPTSARQLDGIRNIVLSNPKKRNTLSLAMLKSLQSDILHDADSNDLKVIIISAEGPVFSSGHDLKELTEEQGRDYHAEVFQTCSKVMMHIRNHPVPVIAMVNGLATAAGCQLVASCDIAVASDKSSFATPGVNVGLFCSTPGVALARAVPRKVALEMLFTGEPISAQEALLHGLLSKVVPEAELQEETMRIARKIASLSRPVVSLGKATFYKQLPQDLGTAYYLTSQAMVDNLALRDGQEGITAFLQKRKPVWSH 287
           ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
2vx2A   45 -------------------------------PRPTSARQLDGIRNIVLSNPKKRNTLSLAMLKSLQSDILHDADSNDLKVIIISAEGPVFSSGHDLKELTEEQGRDYHAEVFQTCSKVMMHIRNHPVPVIAMVNGLATAAGCQLVASCDIAVASDKSSFATPGVNVGLFCSTPGVALARAVPRKVALEMLFTGEPISAQEALLHGLLSKVVPEAELQEETMRIARKIASLSRPVVSLGKATFYKQLPQDLGTAYYLTSQAMVDNLALRDGQEGITAFLQKRKPVWSH 300

We suggest to evaluate this target as a single domain spanning whole chain. However, evolutionarily this is a 2-domain protein:

1st domain: target 32-230 ; pdb 45-243

2nd domain: target 231-287 ; pdb 244-300

Sequence classification:

Enoyl-CoA hydratase/isomerase family (ECH) in Pfam.

Server predictions:

T0486:pdb 45-300:seq 32-287:CM_easy;   alignment

distribution of first scores
First models for T0486: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

486_1:pdb 45-243:seq 32-230:CM_easy;   alignment

distribution of first scores
First models for T0486_1: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

486_2:pdb 244-300:seq 231-287:CM_easy;   alignment

distribution of first scores
First models for T0486_2: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

# GROUP ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ ↓ GROUP #
T0486 486_1 486_2 T0486 486_1 486_2 T0486 486_1 486_2 T0486 486_1 486_2
First score First Z-score Best score Best Z-score
1 RAPTOR 86.72 83.46 86.80 89.70 86.52 87.40 87.28 85.53 87.64 1.90 2.08 1.87 2.96 3.56 2.04 0.67 0.68 0.92 86.72 83.46 87.65 90.70 88.11 87.65 90.35 90.35 92.11 2.25 2.57 2.28 3.17 3.56 2.11 0.48 0.58 1.25 RAPTOR 1
2 Phyre_de_novo 84.67 79.26 85.84 86.94 76.17 86.13 90.35 90.06 88.84 1.57 1.53 1.67 2.12 1.11 1.70 0.91 1.00 1.01 84.67 79.26 85.84 86.94 76.17 86.13 90.35 90.06 88.84 1.67 1.56 1.72 1.86 0.33 1.58 0.48 0.55 0.70 Phyre_de_novo 2
3 HHpred5 83.30 73.08 86.57 87.19 78.98 86.70 87.28 86.70 89.67 1.35 0.72 1.82 2.20 1.78 1.85 0.67 0.76 1.08 83.30 73.08 86.57 87.19 78.98 86.70 87.28 86.70 89.67 1.29 0.09 1.95 1.95 1.09 1.78 0.09 0.18 0.84 HHpred5 3
4 Zhang−Server 82.13 77.12 87.68 86.06 76.00 88.03 89.03 89.03 89.39 1.16 1.25 2.06 1.86 1.07 2.21 0.80 0.93 1.06 82.13 77.12 87.68 86.06 79.31 88.03 89.03 89.03 89.39 0.96 1.05 2.29 1.55 1.18 2.24 0.31 0.43 0.79 Zhang−Server 4
5 MULTICOM−RANK 81.84 76.43 85.80 86.18 80.99 86.06 86.84 85.67 87.97 1.11 1.16 1.66 1.90 2.25 1.68 0.63 0.69 0.94 81.84 76.43 85.80 87.56 83.63 86.06 86.84 85.67 87.97 0.88 0.89 1.71 2.08 2.35 1.55 0.03 0.07 0.56 MULTICOM−RANK 5
6 METATASSER 81.64 75.98 82.46 82.79 76.51 83.58 87.28 87.28 82.37 1.08 1.10 0.95 0.87 1.19 1.00 0.67 0.80 0.49 81.64 75.98 82.46 82.79 76.51 83.58 87.28 87.28 84.67 0.82 0.78 0.67 0.41 0.42 0.69 0.09 0.25 0.00 METATASSER 6
7 BAKER−ROBETTA 81.54 77.44 80.73 81.28 77.01 80.91 91.67 91.08 86.50 1.06 1.29 0.58 0.42 1.31 0.27 1.01 1.07 0.82 82.13 77.77 81.85 82.41 77.01 82.22 91.67 91.08 86.50 0.96 1.21 0.48 0.27 0.56 0.21 0.65 0.66 0.31 BAKER−ROBETTA 7
8 HHpred4 81.44 76.50 83.06 85.68 77.64 82.82 87.72 85.97 90.11 1.05 1.17 1.08 1.75 1.46 0.79 0.70 0.71 1.12 81.44 76.50 83.06 85.68 77.64 82.82 87.72 85.97 90.11 0.76 0.90 0.85 1.42 0.73 0.42 0.14 0.11 0.91 HHpred4 8
9 GS−MetaServer2 80.47 76.56 79.02 80.03 76.00 78.57 93.42 92.84 87.89 0.89 1.18 0.21 0.04 1.07 -0.37 1.15 1.20 0.94 80.47 76.56 79.75 83.17 76.00 79.94 93.42 92.84 87.95 0.49 0.92 -0.18 0.54 0.28 -0.58 0.88 0.85 0.55 GS−MetaServer2 9
10 MUFOLD−Server 80.18 74.64 80.28 81.53 72.49 80.35 85.53 83.19 86.24 0.84 0.92 0.48 0.49 0.24 0.12 0.53 0.51 0.80 80.27 74.64 80.30 81.66 75.59 80.39 85.53 83.19 86.24 0.43 0.46 -0.01 0.01 0.17 -0.42 -0.14 -0.19 0.27 MUFOLD−Server 10
11 HHpred2 80.08 75.91 83.04 84.80 79.44 82.57 89.47 89.47 91.52 0.83 1.09 1.07 1.48 1.89 0.72 0.84 0.96 1.23 80.08 75.91 83.04 84.80 79.44 82.57 89.47 89.47 91.52 0.38 0.76 0.85 1.11 1.21 0.34 0.37 0.48 1.15 HHpred2 11
12 pro−sp3−TASSER 80.08 73.63 85.14 83.79 77.85 85.35 86.40 86.40 87.71 0.83 0.79 1.52 1.18 1.51 1.48 0.60 0.74 0.92 85.45 81.22 87.09 86.56 81.45 87.72 90.79 90.79 87.71 1.89 2.03 2.11 1.73 1.76 2.13 0.54 0.62 0.51 pro−sp3−TASSER 12
13 GeneSilicoMetaServer 79.88 73.89 80.54 80.65 75.13 80.61 85.97 84.21 85.99 0.80 0.83 0.54 0.23 0.87 0.19 0.56 0.59 0.78 80.37 74.58 80.54 80.65 75.13 83.06 92.98 92.40 86.43 0.46 0.45 0.07 -0.34 0.05 0.51 0.82 0.80 0.30 GeneSilicoMetaServer 13
14 mGenTHREADER 79.69 75.65 78.76 79.65 75.80 78.41 92.54 91.96 87.00 0.76 1.06 0.16 -0.07 1.03 -0.42 1.08 1.13 0.86 79.69 75.65 78.76 79.65 75.80 78.41 92.54 91.96 87.00 0.27 0.70 -0.49 -0.69 0.23 -1.11 0.76 0.75 0.39 mGenTHREADER 14
15 FFASsuboptimal 79.49 75.46 79.44 78.77 69.47 79.41 91.67 91.08 86.50 0.73 1.03 0.30 -0.34 -0.47 -0.14 1.01 1.07 0.82 81.84 77.86 80.94 82.16 76.09 80.97 91.67 91.08 86.50 0.88 1.23 0.19 0.19 0.31 -0.22 0.65 0.66 0.31 FFASsuboptimal 15
16 FFASstandard 79.39 75.23 80.30 80.91 70.56 80.42 92.54 91.96 86.54 0.72 1.00 0.49 0.31 -0.21 0.13 1.08 1.13 0.83 81.06 77.34 80.45 81.16 74.67 80.42 92.54 91.96 87.42 0.66 1.10 0.04 -0.16 -0.08 -0.41 0.76 0.75 0.46 FFASstandard 16
17 FFASflextemplate 79.39 75.23 80.30 80.91 70.56 80.42 92.54 91.96 86.54 0.72 1.00 0.49 0.31 -0.21 0.13 1.08 1.13 0.83 81.06 77.34 80.30 81.16 73.16 80.42 92.54 91.96 86.54 0.66 1.10 -0.01 -0.16 -0.49 -0.41 0.76 0.75 0.32 FFASflextemplate 17
18 panther_server 79.39 74.64 74.59 79.15 73.70 74.30 89.91 89.33 83.66 0.72 0.92 -0.73 -0.22 0.53 -1.54 0.87 0.95 0.59 79.39 75.68 76.99 79.65 76.00 78.36 91.67 90.50 84.48 0.19 0.71 -1.04 -0.69 0.28 -1.13 0.65 0.59 -0.03 panther_server 18
19 pipe_int 79.39 73.41 76.20 78.52 72.24 75.63 91.67 91.08 86.50 0.72 0.76 -0.39 -0.41 0.19 -1.18 1.01 1.07 0.82 79.39 73.41 76.20 78.52 72.24 75.63 91.67 91.08 86.50 0.19 0.17 -1.28 -1.09 -0.74 -2.08 0.65 0.66 0.31 pipe_int 19
20 ACOMPMOD 79.39 70.67 80.00 81.66 74.79 80.63 86.84 85.09 81.38 0.72 0.40 0.42 0.53 0.79 0.19 0.63 0.65 0.41 79.39 70.67 80.00 81.66 74.79 80.63 86.84 85.09 81.38 0.19 -0.49 -0.10 0.01 -0.05 -0.34 0.03 0.01 -0.55 ACOMPMOD 20
21 MULTICOM−REFINE 79.30 70.90 82.09 82.66 74.29 82.69 88.16 87.57 84.42 0.70 0.43 0.87 0.84 0.67 0.75 0.73 0.82 0.66 80.18 72.75 82.14 82.66 74.29 82.69 89.91 89.91 86.40 0.41 0.01 0.57 0.36 -0.18 0.38 0.43 0.53 0.29 MULTICOM−REFINE 21
22 keasar−server 79.20 74.32 80.34 80.03 71.73 80.20 85.97 83.63 88.40 0.69 0.88 0.50 0.04 0.07 0.07 0.56 0.54 0.98 79.78 74.32 81.04 81.16 74.71 83.53 85.97 83.77 88.40 0.30 0.38 0.22 -0.16 -0.07 0.67 -0.08 -0.13 0.63 keasar−server 22
23 GS−KudlatyPred 79.20 70.67 79.86 80.15 71.36 79.75 83.77 81.43 87.05 0.69 0.40 0.39 0.08 -0.02 -0.05 0.39 0.39 0.87 79.20 70.67 79.86 80.15 71.36 79.75 83.77 81.43 87.05 0.13 -0.49 -0.14 -0.52 -0.97 -0.65 -0.36 -0.38 0.40 GS−KudlatyPred 23
24 MUSTER 79.10 69.99 81.39 79.77 68.64 81.41 86.40 84.06 87.85 0.67 0.31 0.72 -0.04 -0.66 0.40 0.60 0.57 0.93 79.10 72.49 81.61 81.53 72.99 82.85 91.67 90.06 87.85 0.10 -0.05 0.40 -0.03 -0.53 0.43 0.65 0.55 0.54 MUSTER 24
25 PSI 78.42 72.04 79.99 79.15 70.52 80.04 82.46 78.36 86.53 0.56 0.58 0.42 -0.22 -0.22 0.03 0.29 0.17 0.83 79.00 72.62 80.40 79.77 73.49 80.52 82.46 78.36 86.53 0.08 -0.02 0.02 -0.65 -0.40 -0.38 -0.53 -0.71 0.31 PSI 25
26 Fiser−M4T 78.42 70.15 79.16 80.03 72.07 79.70 82.02 80.26 81.03 0.56 0.33 0.24 0.04 0.15 -0.06 0.25 0.31 0.38 78.42 70.15 79.16 80.03 72.07 79.70 82.02 80.26 81.03 -0.09 -0.61 -0.36 -0.56 -0.78 -0.66 -0.59 -0.51 -0.61 Fiser−M4T 26
27 PS2−server 78.22 71.97 82.79 80.65 70.52 83.09 82.89 79.97 87.45 0.53 0.57 1.02 0.23 -0.22 0.86 0.32 0.29 0.90 78.22 72.69 82.79 80.65 74.33 83.09 91.23 89.47 87.45 -0.14 -0.01 0.77 -0.34 -0.17 0.52 0.60 0.48 0.47 PS2−server 27
28 MUProt 77.44 70.47 81.89 82.41 73.70 82.66 86.40 85.82 83.40 0.40 0.38 0.83 0.76 0.53 0.75 0.60 0.70 0.57 79.20 72.36 82.08 82.54 73.70 82.66 87.72 87.72 86.64 0.13 -0.09 0.55 0.32 -0.34 0.37 0.14 0.29 0.33 MUProt 28
29 MULTICOM−CLUSTER 77.34 71.81 82.04 81.78 75.25 82.41 85.53 85.53 85.72 0.38 0.55 0.86 0.57 0.90 0.68 0.53 0.68 0.76 83.79 71.81 85.57 88.82 85.22 87.61 85.53 85.53 85.72 1.43 -0.22 1.63 2.52 2.78 2.09 -0.14 0.06 0.18 MULTICOM−CLUSTER 29
30 MULTICOM−CMFR 77.34 70.90 81.71 82.03 69.64 82.69 83.77 82.02 82.37 0.38 0.43 0.79 0.65 -0.43 0.75 0.39 0.43 0.49 79.59 74.32 81.93 82.79 74.75 82.69 91.67 91.08 86.59 0.24 0.38 0.50 0.41 -0.06 0.38 0.65 0.66 0.32 MULTICOM−CMFR 30
31 Pushchino 76.66 70.08 76.13 77.01 65.28 75.46 85.97 84.21 87.42 0.27 0.32 -0.40 -0.87 -1.46 -1.22 0.56 0.59 0.90 76.66 70.08 76.13 77.01 65.28 75.46 85.97 84.21 87.42 -0.58 -0.63 -1.31 -1.61 -2.62 -2.14 -0.08 -0.08 0.46 Pushchino 31
32 OLGAFS 76.27 68.91 71.91 76.26 69.56 71.56 93.42 92.25 86.87 0.21 0.17 -1.30 -1.09 -0.45 -2.29 1.15 1.15 0.85 76.66 72.56 71.91 76.26 72.40 71.56 93.42 92.40 87.43 -0.58 -0.04 -2.62 -1.88 -0.69 -3.50 0.88 0.80 0.47 OLGAFS 32
33 mariner1 75.98 70.67 70.11 78.89 66.50 75.91 75.88 71.20 51.31 0.16 0.40 -1.69 -0.30 -1.17 -1.10 -0.23 -0.33 -2.02 79.59 74.51 79.94 79.77 75.42 82.67 89.03 87.86 87.18 0.24 0.43 -0.12 -0.65 0.13 0.37 0.31 0.31 0.42 mariner1 33
34 rehtnap 75.88 69.82 75.15 80.03 72.07 75.42 83.77 83.77 80.87 0.15 0.29 -0.61 0.04 0.15 -1.23 0.39 0.55 0.37 75.88 69.82 75.15 80.03 72.07 75.42 84.65 84.65 80.87 -0.80 -0.69 -1.61 -0.56 -0.78 -2.16 -0.25 -0.04 -0.63 rehtnap 34
35 Pcons_dot_net 75.19 67.45 73.54 77.01 70.64 73.96 84.65 77.92 78.12 0.04 -0.02 -0.96 -0.87 -0.19 -1.63 0.46 0.14 0.15 82.13 77.77 81.85 82.41 74.75 82.85 91.67 91.08 86.50 0.96 1.21 0.48 0.27 -0.06 0.43 0.65 0.66 0.31 Pcons_dot_net 35
36 Pcons_multi 75.19 67.45 73.54 77.01 70.64 73.96 84.65 77.92 78.12 0.04 -0.02 -0.96 -0.87 -0.19 -1.63 0.46 0.14 0.15 80.86 72.79 80.25 81.53 72.19 80.16 93.42 92.84 87.47 0.60 0.02 -0.02 -0.03 -0.75 -0.50 0.88 0.85 0.47 Pcons_multi 36
37 Pcons_local 74.81 64.49 79.23 79.40 72.45 82.85 75.00 67.11 64.93 -0.03 -0.41 0.26 -0.15 0.24 0.80 -0.30 -0.62 -0.92 78.61 72.43 80.82 84.05 76.67 83.58 89.47 88.89 84.98 -0.03 -0.07 0.16 0.85 0.46 0.69 0.37 0.42 0.05 Pcons_local 37
38 FAMSD 74.32 63.70 77.90 78.77 69.56 81.26 73.68 68.13 64.15 -0.11 -0.51 -0.02 -0.34 -0.45 0.36 -0.40 -0.55 -0.98 80.57 73.41 80.45 81.53 76.13 81.49 93.42 92.40 85.66 0.52 0.17 0.04 -0.03 0.32 -0.04 0.88 0.80 0.17 FAMSD 38
39 FALCON 74.02 67.97 75.28 79.40 72.45 78.10 66.23 56.29 69.32 -0.15 0.05 -0.58 -0.15 0.24 -0.50 -0.98 -1.39 -0.56 74.02 67.97 75.47 79.40 72.45 79.65 66.23 58.04 69.32 -1.33 -1.13 -1.51 -0.78 -0.68 -0.68 -2.62 -2.90 -2.57 FALCON 39
40 YASARA 73.93 70.22 72.31 74.12 71.02 71.95 89.03 88.16 81.36 -0.17 0.34 -1.22 -1.74 -0.10 -2.18 0.80 0.86 0.41 77.93 72.59 74.86 77.39 73.91 73.61 92.98 92.40 89.95 -0.23 -0.03 -1.70 -1.48 -0.28 -2.79 0.82 0.80 0.89 YASARA 40
41 Frankenstein 73.83 63.61 78.96 78.39 68.76 82.06 77.63 72.95 67.42 -0.18 -0.52 0.20 -0.45 -0.64 0.58 -0.09 -0.21 -0.72 76.66 68.85 81.84 79.27 70.48 82.41 80.26 74.42 88.11 -0.58 -0.92 0.47 -0.82 -1.21 0.28 -0.82 -1.14 0.58 Frankenstein 41
42 Poing 73.53 62.79 76.74 77.64 69.85 79.88 74.56 68.13 64.81 -0.23 -0.63 -0.27 -0.68 -0.38 -0.01 -0.33 -0.55 -0.93 80.47 75.19 80.67 80.28 75.13 80.62 92.11 91.52 87.42 0.49 0.59 0.11 -0.47 0.05 -0.34 0.71 0.70 0.46 Poing 42
43 Phyre2 73.53 62.79 76.74 77.64 69.85 79.88 74.56 68.13 64.81 -0.23 -0.63 -0.27 -0.68 -0.38 -0.01 -0.33 -0.55 -0.93 80.47 75.19 80.66 80.15 75.13 80.61 92.11 91.52 87.42 0.49 0.59 0.11 -0.52 0.05 -0.35 0.71 0.70 0.46 Phyre2 43
44 Phragment 73.53 62.79 76.78 77.89 70.10 79.92 74.56 68.13 64.81 -0.23 -0.63 -0.26 -0.60 -0.32 -0.00 -0.33 -0.55 -0.93 80.47 75.19 80.65 80.15 75.13 80.60 92.11 91.52 87.42 0.49 0.59 0.10 -0.52 0.05 -0.35 0.71 0.70 0.46 Phragment 44
45 CpHModels 73.44 64.52 67.37 74.00 66.37 68.50 82.89 81.72 69.88 -0.25 -0.41 -2.27 -1.77 -1.20 -3.12 0.32 0.41 -0.52 73.44 64.52 67.37 74.00 66.37 68.50 82.89 81.72 69.88 -1.49 -1.96 -4.03 -2.67 -2.32 -4.57 -0.48 -0.35 -2.48 CpHModels 45
46 SAM−T02−server 73.05 61.98 78.67 77.89 70.94 78.46 85.97 85.67 85.86 -0.31 -0.74 0.14 -0.60 -0.12 -0.40 0.56 0.69 0.77 79.20 72.95 78.90 79.90 74.62 82.15 85.97 85.67 87.79 0.13 0.06 -0.44 -0.60 -0.09 0.19 -0.08 0.07 0.53 SAM−T02−server 46
47 LEE−SERVER 72.27 64.58 84.71 86.68 77.64 88.21 67.98 59.50 69.41 -0.44 -0.40 1.43 2.05 1.46 2.26 -0.85 -1.16 -0.56 73.63 68.42 85.04 87.94 82.03 88.41 67.98 65.50 70.40 -1.44 -1.03 1.47 2.21 1.91 2.37 -2.40 -2.10 -2.39 LEE−SERVER 47
48 fais−server 72.17 59.38 78.48 78.64 67.67 82.11 67.54 56.14 64.06 -0.45 -1.08 0.10 -0.38 -0.89 0.60 -0.88 -1.40 -0.99 79.00 72.88 80.14 80.65 75.88 82.11 91.67 91.08 87.20 0.08 0.04 -0.06 -0.34 0.25 0.18 0.65 0.66 0.43 fais−server 48
49 circle 70.61 61.03 77.54 78.39 69.43 80.87 71.05 61.70 63.86 -0.71 -0.86 -0.10 -0.45 -0.48 0.26 -0.61 -1.01 -1.00 70.61 61.03 77.54 78.39 70.18 80.87 71.05 61.70 63.86 -2.29 -2.79 -0.87 -1.13 -1.29 -0.26 -2.00 -2.51 -3.49 circle 49
50 FEIG 69.24 60.91 75.60 82.16 72.32 80.13 55.70 54.83 56.89 -0.93 -0.88 -0.52 0.68 0.20 0.05 -1.81 -1.49 -1.57 83.59 79.23 81.80 84.42 79.31 82.33 89.47 89.47 83.86 1.37 1.56 0.46 0.98 1.18 0.25 0.37 0.48 -0.13 FEIG 50
51 3D−JIGSAW_V3 67.87 61.88 74.51 82.03 73.49 79.40 56.14 53.51 53.11 -1.15 -0.75 -0.75 0.65 0.48 -0.14 -1.77 -1.59 -1.87 68.36 61.88 75.27 82.54 73.49 79.40 56.58 53.95 65.79 -2.93 -2.59 -1.57 0.32 -0.40 -0.77 -3.87 -3.34 -3.16 3D−JIGSAW_V3 51
52 BioSerf 67.87 57.06 80.46 83.42 71.48 86.61 42.10 37.87 54.79 -1.15 -1.38 0.52 1.06 0.01 1.83 -2.88 -2.69 -1.74 67.87 57.06 80.46 83.42 71.48 86.61 42.10 37.87 54.79 -3.06 -3.74 0.04 0.63 -0.94 1.74 -5.73 -5.07 -5.01 BioSerf 52
53 3D−JIGSAW_AEP 65.53 58.69 75.60 79.90 71.27 79.57 53.95 50.73 64.24 -1.53 -1.17 -0.52 0.00 -0.04 -0.10 -1.95 -1.78 -0.97 78.71 74.09 78.14 82.66 78.81 79.57 89.03 89.03 88.36 -0.01 0.33 -0.68 0.36 1.04 -0.71 0.31 0.43 0.62 3D−JIGSAW_AEP 53
54 3DShot2 65.53 55.44 70.08 77.76 67.46 77.37 43.42 33.77 36.07 -1.53 -1.60 -1.69 -0.64 -0.94 -0.70 -2.77 -2.98 -3.25 65.53 55.44 70.08 77.76 67.46 77.37 43.42 33.77 36.07 -3.72 -4.13 -3.19 -1.35 -2.03 -1.48 -5.56 -5.51 -8.14 3DShot2 54
55 Distill 64.65 54.56 64.50 64.57 54.44 64.42 78.07 68.13 75.95 -1.67 -1.71 -2.88 -4.61 -4.02 -4.24 -0.06 -0.55 -0.03 66.41 56.84 67.54 68.84 58.00 67.37 84.65 83.48 79.02 -3.48 -3.79 -3.98 -4.47 -4.59 -4.96 -0.25 -0.16 -0.94 Distill 55
56 SAM−T06−server 63.77 55.24 76.27 77.64 67.84 79.20 47.37 47.37 66.55 -1.81 -1.62 -0.37 -0.68 -0.85 -0.20 -2.46 -2.02 -0.79 80.08 72.40 82.68 84.55 80.61 82.29 92.54 91.96 90.86 0.38 -0.08 0.73 1.02 1.53 0.24 0.76 0.75 1.04 SAM−T06−server 56
57 SAM−T08−server 63.67 55.60 71.95 76.13 66.75 76.54 54.83 48.39 55.23 -1.83 -1.58 -1.29 -1.13 -1.11 -0.93 -1.88 -1.95 -1.70 73.34 66.24 76.95 77.39 68.13 80.25 79.83 75.73 83.96 -1.52 -1.55 -1.05 -1.48 -1.85 -0.47 -0.87 -1.00 -0.12 SAM−T08−server 57
58 nFOLD3 62.11 52.18 68.72 76.13 62.73 73.85 50.88 48.83 48.88 -2.08 -2.03 -1.98 -1.13 -2.06 -1.66 -2.19 -1.92 -2.21 79.39 74.51 80.21 83.54 80.44 82.53 87.72 87.72 86.77 0.19 0.43 -0.03 0.67 1.48 0.32 0.14 0.29 0.35 nFOLD3 58
59 COMA 60.94 51.69 74.16 73.49 61.85 76.52 60.09 59.21 65.79 -2.27 -2.09 -0.82 -1.93 -2.27 -0.93 -1.47 -1.18 -0.85 75.49 67.35 80.01 79.15 70.18 81.20 84.65 82.60 84.26 -0.91 -1.28 -0.10 -0.87 -1.29 -0.14 -0.25 -0.26 -0.07 COMA 59
60 COMA−M 60.94 51.69 74.16 73.49 61.85 76.52 60.09 59.21 65.79 -2.27 -2.09 -0.82 -1.93 -2.27 -0.93 -1.47 -1.18 -0.85 69.63 64.36 76.53 81.91 76.47 81.20 60.09 59.21 65.79 -2.57 -2.00 -1.18 0.10 0.41 -0.14 -3.41 -2.78 -3.16 COMA−M 60
61 FUGUE_KM 60.45 51.27 67.87 76.13 64.32 77.65 39.47 38.60 31.67 -2.35 -2.15 -2.16 -1.13 -1.69 -0.62 -3.08 -2.64 -3.61 74.90 71.52 70.32 76.13 64.82 77.65 87.72 78.36 76.27 -1.08 -0.29 -3.11 -1.92 -2.74 -1.38 0.14 -0.71 -1.41 FUGUE_KM 61
62 FALCON_CONSENSUS 59.38 53.19 66.66 74.75 66.04 75.76 38.60 36.55 35.08 -2.53 -1.89 -2.42 -1.55 -1.28 -1.14 -3.15 -2.79 -3.33 74.02 67.97 75.47 79.40 72.45 79.65 66.23 58.04 69.32 -1.33 -1.13 -1.51 -0.78 -0.68 -0.68 -2.62 -2.90 -2.57 FALCON_CONSENSUS 62
63 LOOPP_Server 56.25 45.70 69.65 71.98 58.42 77.47 67.11 63.60 49.46 -3.03 -2.88 -1.78 -2.38 -3.08 -0.67 -0.92 -0.87 -2.17 78.22 71.19 80.30 79.65 72.28 80.29 92.98 91.81 87.11 -0.14 -0.36 -0.01 -0.69 -0.72 -0.46 0.82 0.73 0.41 LOOPP_Server 63
64 3Dpro 53.32 44.47 68.15 68.09 56.70 74.16 70.61 68.86 57.83 -3.51 -3.04 -2.10 -3.55 -3.49 -1.58 -0.64 -0.50 -1.49 77.44 71.45 79.79 79.77 75.33 80.27 88.16 85.82 83.83 -0.36 -0.30 -0.17 -0.65 0.10 -0.47 0.20 0.09 -0.14 3Dpro 64
65 RBO−Proteus 20.51 19.82 44.79 26.13 25.21 47.22 41.67 36.70 52.02 -8.82 -6.27 -7.09 -16.19 -10.93 -8.94 -2.91 -2.78 -1.96 21.19 19.82 44.79 26.13 25.21 47.22 45.61 41.23 52.45 -16.23 -12.64 -11.07 -19.41 -13.46 -11.99 -5.28 -4.71 -5.40 RBO−Proteus 65
66 FOLDpro 18.85 16.96 18.80 24.25 21.40 25.35 26.32 24.12 6.34 -9.09 -6.65 -12.63 -16.76 -11.83 -14.92 -4.11 -3.67 -5.65 70.61 64.22 75.18 77.39 68.51 78.30 62.72 58.63 67.04 -2.29 -2.03 -1.60 -1.48 -1.74 -1.15 -3.07 -2.84 -2.95 FOLDpro 66
67 MUFOLD−MD 18.16 16.41 39.25 22.99 20.56 42.36 36.40 24.12 45.99 -9.20 -6.72 -8.27 -17.14 -12.02 -10.27 -3.32 -3.67 -2.45 18.16 16.41 39.25 22.99 20.56 42.36 42.10 35.53 54.68 -17.08 -13.46 -12.79 -20.51 -14.71 -13.68 -5.73 -5.33 -5.02 MUFOLD−MD 67
68 RANDOM 10.66 9.24 10.66 12.50 10.44 12.50 36.99 32.03 36.99 -10.42 -7.66 -14.37 -20.30 -14.42 -18.43 -3.28 -3.11 -3.18 10.66 9.24 10.66 12.50 10.44 12.50 36.99 32.03 36.99 -19.20 -15.17 -21.69 -24.17 -17.45 -24.10 -6.39 -5.70 -7.99 RANDOM 68
69 schenk−torda−server 8.69 8.11 3.54 9.80 8.46 10.18 24.56 21.93 -7.09 -10.74 -7.81 -15.89 -21.11 -14.88 -19.07 -4.25 -3.82 -6.74 9.38 8.79 9.44 11.31 9.17 13.70 37.72 35.09 12.41 -19.56 -15.28 -22.07 -24.59 -17.80 -23.68 -6.29 -5.37 -12.11 schenk−torda−server 69
70 BHAGEERATH                                                       -10.42 -7.66 -14.37 -20.30 -14.42 -18.43 -3.28 -3.11 -3.18                                                       -19.20 -15.17 -21.69 -24.17 -17.45 -24.10 -6.39 -5.70 -7.99 BHAGEERATH 70
71 forecast                                                       -10.42 -7.66 -14.37 -20.30 -14.42 -18.43 -3.28 -3.11 -3.18                                                       -19.20 -15.17 -21.69 -24.17 -17.45 -24.10 -6.39 -5.70 -7.99 forecast 71
72 huber−torda−server                                                       -10.42 -7.66 -14.37 -20.30 -14.42 -18.43 -3.28 -3.11 -3.18                                                       -19.20 -15.17 -21.69 -24.17 -17.45 -24.10 -6.39 -5.70 -7.99 huber−torda−server 72
73 mahmood−torda−server                                                       -10.42 -7.66 -14.37 -20.30 -14.42 -18.43 -3.28 -3.11 -3.18                                                       -19.34 -15.48 -21.69 -24.77 -17.63 -24.10 -6.86 -5.91 -7.99 mahmood−torda−server 73
74 test_http_server_01                                                       -10.42 -7.66 -14.37 -20.30 -14.42 -18.43 -3.28 -3.11 -3.18                                                       -19.20 -15.17 -21.69 -24.17 -17.45 -24.10 -6.39 -5.70 -7.99 test_http_server_01 74