T0416

Targets
387 388 389 390
391 392 393 394
395 396 397 398
399 400 401 402
403 404 405 406
407 408 409 410
411 412 413 414
415 416 417 418
419 420 421 422
423 424 425 426
427 428 429 430
431 432 433 434
435 436 437 438
439 440 441 442
443 444 445 446
447 448 449 450
451 452 453 454
455 456 457 458
459 460 461 462
463 464 465 466
467 468 469 470
471 472 473 474
475 476 477 478
479 480 481 482
483 484 485 486
487 488 489 490
491 492 493 494
495 496 497 498
499 500 501 502
503 504 505 506
507 508 509 510
511 512 513 514

T0416

tRNA delta(2)-isopentenylpyrophosphate transferase from Staphylococcus epidermidis

Target type: Server only

Target sequence:

>T0416 tRNA delta(2)-isopentenylpyrophosphate transferase, Staphylococcus epidermidis, 332 residues
MTEMTKPFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSMQVYQGMDIGTAKVTTEEMEGIPHYMIDILPPDASFSAYEFKKRAEKYIKDITRRGKVPIIAGGTGLYIQSLLYNYAFEDESISEDKMKQVKLKLKELEHLNNNKLHEYLASFDKESAKDIHPNNRKRVLRAIEYYLKTKKLLSSRKKVQQFTENYDTLLIGIEMSRETLYLRINKRVDIMLGHGLFNEVQHLVEQGFEASQSMQAIGYKELVPVIKGNISMENAVEKLKQHSRQYAKRQLTWFKNKMNVHWLNKERMSLQMMLDEITTQINKRSSNHDCKRKHPRPSTREL

Structure:
Method: X-ray, res=2.7Å, R/Rfree=0.23/0.27
Determined by: NESG
PDB ID: 3d3q

3d3q_A cartoon
Cartoon diagram of 416: 3d3q chain A residues

PyMOL of 3d3q

Domains:  PyMOL of domains

Three domains. Residue ranges in PDB: 6-114,194-205,280-315; 115-193 and 206-279. Residue ranges in target: 6-114,194-205,280-315; 115-193 and 206-279.

416 domain evaluation plot
Correlation between weighted by the number of residues sum of GDT-TS scores for domain-based evlatuation (y, vertical axis) and whole chain GDT-TS (x, horizontal axis).

To compute the weighted sum, GDT-TS for each domain was multiplied by the domain length, and this sum was divided by the sum of domain lengths. Each point represents first server model. Green, gray and black points are top 10, bottom 25% and the rest of prediction models. Blue line is the best-fit slope line (intersection 0) to the top 10 server models. Red line is the diagonal. Slope and root mean square y-x distance for the top 10 models (average difference between the weighted sum of domain GDT-TS scores and the whole chain GDT-TS score) are shown above the plot.

Structure classification:

Larger domain: P-loop-containing nucleoside triphosphate hydrolase fold. Insertion domain is a LEM/SAP HeH motif.

CASP category:

Whole chain: Comparative modeling:hard.

1st domain (merge ranges in PDB: 6-114,194-205,280-315 and 206-279 for evaluation): Comparative modeling:easy. 2nd domain: Fold recognition.

Closest templates:

2qgn.

Target sequence - PDB file inconsistencies:

T0416    3d3q.pdb    T0416.pdb    PyMOL    PyMOL of domains    

T0416    1 MTEMTKPFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSMQVYQGMDIGTAKVTTEEMEGIPHYMIDILPPDASFSAYEFKKRAEKYIKDITRRGKVPIIAGGTGLYIQSLLYNYAFEDESISEDKMKQVKLKLKELEHLNNNKLHEYLASFDKESAKDIHPNNRKRVLRAIEYYLKTKKLLSSRKKVQQFTENYDTLLIGIEMSRETLYLRINKRVDIMLGHGLFNEVQHLVEQGFEASQSMQAIGYKELVPVIKGNISMENAVEKLKQHSRQYAKRQLTWFKNKMNVHWLNKERMSLQMMLDEITTQINKRSSNHDCKRKHPRPSTREL 332
           ~~~~~||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~~~~~~~~~~~
3d3qA    6 -----KPFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSMQVYQGMDIGTAKVTTEEMEGIPHYMIDILPPDASFSAYEFKKRAEKYIKDITRRGKVPIIAGGTGLYIQSLLYNYAFE---ISEDKMKQVKLKLKELEHLNNNKLHEYLASFDKESAKDIHPNNRKRVLRAIEYYLKTKKLLSSRKKVQQFTENYDTLLIGIEMSRETLYLRINKRVDIMLGHGLFNEVQHLVEQGFEASQSMQAIGYKELVPVIKGNISMENAVEKLKQHSRQYAKRQLTWFKNKMNVHWLNKERMSLQMMLDEITTQINKRS----------------- 315

Residue change log: change 41, 47, 59, 66, 128, 205, 221, 244, 262, 288, 298, 302, 303, MSE to MET;

2-domain protein, both domains used in evaluation:

1st domain: target 6-114, 194-315 ; pdb 6-114, 194-315

2nd domain: target 115-119, 123-193 ; pdb 115-119, 123-193

Sequence classification:

IPP transferase family (IPPT) in Pfam.

Server predictions:

T0416:pdb 6-315:seq 6-315:CM_hard;   alignment

distribution of first scores
First models for T0416: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

416_1:pdb 6-114,194-315:seq 6-114,194-315:CM_easy;   alignment

distribution of first scores
First models for T0416_1: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

416_2:pdb 115-193:seq 115-193:FR;   alignment

distribution of first scores
First models for T0416_2: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

# GROUP ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ ↓ GROUP #
T0416 416_1 416_2 T0416 416_1 416_2 T0416 416_1 416_2 T0416 416_1 416_2
First score First Z-score Best score Best Z-score
1 keasar−server 66.61 57.27 66.14 87.01 85.14 88.09 19.41 16.89 -4.42 0.85 0.37 1.16 0.81 0.94 1.02 -0.11 -0.06 -0.10 67.83 65.74 67.07 87.12 85.53 88.36 22.70 18.64 -0.91 0.95 1.05 0.88 0.78 0.98 0.93 -0.53 -0.72 -0.79 keasar−server 1
2 Zhang−Server 66.53 62.13 70.06 85.71 81.53 85.43 25.33 17.43 21.68 0.85 0.77 1.51 0.72 0.72 0.84 0.64 0.02 0.87 67.83 65.28 79.04 87.99 85.17 87.71 55.92 41.89 62.52 0.95 0.99 2.06 0.89 0.94 0.86 2.93 2.24 1.86 Zhang−Server 2
3 HHpred2 66.37 65.28 63.05 87.12 85.46 88.21 14.14 12.72 -20.21 0.83 1.02 0.88 0.82 0.96 1.03 -0.77 -0.65 -0.68 66.37 65.28 63.05 87.12 85.46 88.21 14.14 12.72 -20.21 0.75 0.99 0.48 0.78 0.97 0.91 -1.43 -1.48 -1.60 HHpred2 3
4 SAM−T06−server 66.12 64.77 74.82 86.91 85.25 86.95 31.25 26.64 38.52 0.81 0.98 1.94 0.81 0.95 0.94 1.39 1.33 1.50 66.12 64.77 74.82 86.91 85.25 86.95 31.25 26.64 38.52 0.71 0.92 1.64 0.76 0.95 0.79 0.36 0.30 0.86 SAM−T06−server 4
5 FAMSD 65.96 64.66 67.12 86.04 85.17 86.72 21.38 17.00 4.35 0.80 0.97 1.24 0.75 0.95 0.93 0.14 -0.04 0.23 65.96 64.66 67.12 86.04 85.17 86.72 31.58 30.81 36.07 0.69 0.91 0.89 0.65 0.94 0.77 0.39 0.83 0.76 FAMSD 5
6 LEE−SERVER 65.96 64.60 65.18 87.01 85.35 87.07 17.43 13.49 -5.21 0.80 0.97 1.07 0.81 0.96 0.95 -0.36 -0.54 -0.12 66.20 64.69 65.95 87.01 85.35 87.07 20.39 18.86 -1.41 0.72 0.91 0.77 0.77 0.96 0.80 -0.78 -0.69 -0.81 LEE−SERVER 6
7 BAKER−ROBETTA 65.96 64.55 77.12 86.47 85.53 87.96 34.54 32.02 45.65 0.80 0.97 2.15 0.78 0.97 1.01 1.80 2.10 1.76 67.02 65.55 80.51 86.80 85.53 88.43 56.58 41.67 59.63 0.84 1.03 2.21 0.74 0.98 0.94 3.00 2.21 1.74 BAKER−ROBETTA 7
8 forecast 65.96 64.17 63.57 86.91 85.39 88.43 16.78 13.93 -18.09 0.80 0.93 0.92 0.81 0.96 1.04 -0.44 -0.48 -0.60 66.53 65.12 64.63 87.34 85.68 88.45 17.11 15.24 -13.23 0.77 0.97 0.64 0.81 1.00 0.94 -1.12 -1.15 -1.31 forecast 8
9 circle 65.80 64.77 67.67 86.36 85.14 86.18 22.37 18.86 8.78 0.78 0.98 1.29 0.77 0.94 0.89 0.27 0.22 0.39 65.96 64.77 67.67 86.36 85.17 86.72 22.37 19.74 8.78 0.69 0.92 0.94 0.69 0.94 0.77 -0.57 -0.58 -0.39 circle 9
10 Pushchino 65.72 64.47 57.17 86.58 85.28 87.71 8.55 8.11 -45.84 0.78 0.96 0.35 0.78 0.95 0.99 -1.48 -1.31 -1.63 65.72 64.47 57.17 86.58 85.28 87.71 8.55 8.11 -45.84 0.65 0.88 -0.09 0.72 0.95 0.86 -2.01 -2.06 -2.67 Pushchino 10
11 3D−JIGSAW_V3 65.72 64.36 57.29 86.80 85.50 88.00 6.58 6.36 -46.43 0.78 0.95 0.36 0.80 0.97 1.01 -1.73 -1.56 -1.65 65.72 64.47 57.29 86.80 85.50 88.00 6.58 6.36 -46.43 0.65 0.88 -0.08 0.74 0.98 0.89 -2.21 -2.29 -2.69 3D−JIGSAW_V3 11
12 3D−JIGSAW_AEP 65.72 64.09 57.44 86.91 85.17 88.18 6.58 6.36 -46.41 0.78 0.93 0.37 0.81 0.95 1.03 -1.73 -1.56 -1.65 65.80 64.17 57.48 86.91 85.17 88.23 6.58 6.36 -46.41 0.67 0.84 -0.06 0.76 0.94 0.92 -2.21 -2.29 -2.69 3D−JIGSAW_AEP 12
13 COMA−M 65.64 63.19 59.08 85.93 83.69 83.30 13.49 11.84 -20.70 0.77 0.85 0.52 0.74 0.85 0.69 -0.86 -0.78 -0.70 65.64 63.19 59.08 85.93 83.69 83.30 13.82 11.84 -20.70 0.64 0.72 0.09 0.64 0.79 0.43 -1.46 -1.59 -1.62 COMA−M 13
14 nFOLD3 65.47 63.95 57.25 86.58 85.35 87.93 7.57 6.25 -46.26 0.76 0.92 0.35 0.78 0.96 1.01 -1.60 -1.58 -1.65 65.47 63.95 57.25 86.58 85.35 87.93 31.58 27.63 13.81 0.62 0.82 -0.09 0.72 0.96 0.89 0.39 0.42 -0.18 nFOLD3 14
15 SAM−T02−server 65.39 64.25 56.54 86.04 84.60 86.95 8.55 8.11 -45.84 0.75 0.94 0.29 0.75 0.91 0.94 -1.48 -1.31 -1.63 65.39 64.25 56.54 86.04 84.60 86.95 18.42 17.76 -24.87 0.61 0.86 -0.16 0.65 0.88 0.79 -0.98 -0.83 -1.79 SAM−T02−server 15
16 GS−KudlatyPred 65.06 61.10 56.65 86.04 84.23 87.83 5.92 5.92 -46.46 0.72 0.68 0.30 0.75 0.89 1.00 -1.81 -1.62 -1.65 65.06 61.10 56.65 86.04 84.23 87.83 5.92 5.92 -46.46 0.56 0.44 -0.15 0.65 0.84 0.88 -2.28 -2.34 -2.70 GS−KudlatyPred 16
17 OLGAFS 64.90 60.67 56.25 85.93 78.21 86.85 6.91 6.47 -46.79 0.71 0.65 0.26 0.74 0.51 0.93 -1.69 -1.55 -1.67 64.90 60.67 56.25 85.93 78.21 86.85 8.88 6.47 -43.73 0.54 0.39 -0.19 0.64 0.21 0.78 -1.98 -2.27 -2.58 OLGAFS 17
18 HHpred5 64.90 58.77 60.65 85.50 79.80 85.47 13.16 12.28 -20.73 0.71 0.49 0.66 0.71 0.61 0.84 -0.90 -0.72 -0.70 64.90 58.77 60.65 85.50 79.80 85.47 13.16 12.28 -20.73 0.54 0.14 0.25 0.58 0.38 0.64 -1.53 -1.53 -1.62 HHpred5 18
19 YASARA 64.82 56.76 74.50 85.50 74.71 88.87 26.64 26.21 31.41 0.70 0.33 1.91 0.71 0.29 1.07 0.81 1.27 1.23 64.82 57.06 74.50 85.50 75.40 88.87 28.29 27.63 31.41 0.53 -0.09 1.61 0.58 -0.09 0.98 0.05 0.42 0.56 YASARA 19
20 MUFOLD−Server 64.66 61.40 60.03 84.63 83.12 85.23 14.80 11.29 -22.62 0.69 0.71 0.61 0.65 0.82 0.82 -0.69 -0.86 -0.77 64.66 61.40 60.03 84.63 83.12 85.23 14.80 11.29 -22.62 0.50 0.48 0.19 0.48 0.73 0.62 -1.36 -1.66 -1.70 MUFOLD−Server 20
21 HHpred4 64.58 60.61 60.41 85.50 79.15 86.09 12.83 12.39 -24.04 0.68 0.64 0.64 0.71 0.57 0.88 -0.94 -0.70 -0.82 64.58 60.61 60.41 85.50 79.15 86.09 12.83 12.39 -24.04 0.49 0.38 0.22 0.58 0.31 0.70 -1.56 -1.52 -1.76 HHpred4 21
22 panther_server 63.52 60.53 53.33 83.55 79.29 83.03 10.53 10.31 -45.58 0.59 0.64 0.00 0.58 0.58 0.67 -1.23 -1.00 -1.62 63.52 60.53 53.33 83.55 79.29 83.03 21.05 18.42 8.73 0.34 0.37 -0.47 0.34 0.32 0.40 -0.71 -0.75 -0.39 panther_server 22
23 METATASSER 63.52 57.93 66.86 82.79 79.91 75.77 33.88 31.03 45.61 0.59 0.43 1.22 0.53 0.62 0.17 1.72 1.96 1.76 64.74 61.43 71.80 84.74 80.77 82.66 41.45 37.50 45.61 0.51 0.48 1.35 0.49 0.48 0.36 1.42 1.68 1.15 METATASSER 23
24 SAM−T08−server 62.30 60.23 73.37 82.03 79.65 84.94 31.25 29.28 40.15 0.48 0.61 1.81 0.47 0.60 0.80 1.39 1.71 1.56 65.96 64.44 76.18 86.69 85.46 88.11 31.25 29.28 40.72 0.69 0.88 1.78 0.73 0.97 0.90 0.36 0.63 0.95 SAM−T08−server 24
25 Phyre_de_novo 61.89 55.65 66.23 80.30 72.51 76.97 27.30 25.44 36.44 0.45 0.24 1.16 0.36 0.16 0.25 0.89 1.16 1.42 61.89 56.11 66.23 81.71 74.57 78.74 27.30 26.64 36.44 0.11 -0.21 0.80 0.12 -0.17 -0.02 -0.05 0.30 0.77 Phyre_de_novo 25
26 PS2−server 61.56 56.35 48.81 81.82 74.89 79.26 0.00 0.00 -47.75 0.42 0.30 -0.41 0.46 0.31 0.41 -2.56 -2.47 -1.70 61.56 56.35 48.81 81.82 74.89 79.26 33.22 31.47 39.09 0.06 -0.18 -0.92 0.13 -0.14 0.03 0.56 0.91 0.88 PS2−server 26
27 Poing 61.08 59.50 46.93 80.95 76.12 76.45 3.95 3.95 -47.30 0.38 0.55 -0.58 0.40 0.38 0.22 -2.06 -1.91 -1.68 61.08 59.50 61.46 80.95 76.12 77.33 29.28 28.84 35.96 -0.00 0.23 0.33 0.03 -0.01 -0.16 0.15 0.58 0.75 Poing 27
28 Phyre2 61.08 59.50 46.93 80.95 76.12 76.45 3.95 3.95 -47.30 0.38 0.55 -0.58 0.40 0.38 0.22 -2.06 -1.91 -1.68 61.08 59.50 63.83 80.95 76.12 77.48 34.87 33.99 38.39 -0.00 0.23 0.56 0.03 -0.01 -0.15 0.73 1.23 0.85 Phyre2 28
29 Phragment 61.08 59.50 46.93 80.95 76.12 76.45 3.95 3.95 -47.30 0.38 0.55 -0.58 0.40 0.38 0.22 -2.06 -1.91 -1.68 61.08 59.50 60.02 80.95 76.12 77.80 28.29 27.19 38.63 -0.00 0.23 0.19 0.03 -0.01 -0.12 0.05 0.37 0.86 Phragment 29
30 3DShot2 60.99 57.47 55.07 80.41 76.01 78.52 16.45 14.36 -18.81 0.37 0.39 0.16 0.36 0.38 0.36 -0.48 -0.42 -0.63 60.99 57.47 55.07 80.41 76.01 78.52 16.45 14.36 -18.81 -0.02 -0.04 -0.30 -0.04 -0.02 -0.05 -1.19 -1.27 -1.54 3DShot2 30
31 RAPTOR 60.51 57.36 48.65 80.09 75.18 75.80 8.88 8.22 -37.39 0.33 0.38 -0.42 0.34 0.32 0.17 -1.44 -1.30 -1.32 60.51 57.36 48.65 80.09 75.18 75.80 18.42 17.11 -5.15 -0.08 -0.05 -0.93 -0.08 -0.11 -0.31 -0.98 -0.92 -0.97 RAPTOR 31
32 rehtnap 60.34 53.23 55.97 79.11 69.23 76.97 18.42 12.83 -9.65 0.31 0.04 0.24 0.28 -0.05 0.25 -0.23 -0.64 -0.29 60.34 53.23 60.24 79.11 69.23 76.97 29.61 25.88 18.66 -0.11 -0.59 0.21 -0.20 -0.74 -0.20 0.19 0.20 0.03 rehtnap 32
33 COMA 60.10 55.86 48.96 78.90 75.58 72.08 11.84 11.84 -22.81 0.29 0.26 -0.39 0.26 0.35 -0.08 -1.06 -0.78 -0.78 65.72 64.41 61.02 86.47 84.81 85.74 13.16 11.84 -20.70 0.65 0.88 0.28 0.70 0.90 0.67 -1.53 -1.59 -1.62 COMA 33
34 MUSTER 60.02 55.95 53.28 79.55 74.13 73.18 18.09 12.83 -5.92 0.29 0.26 -0.00 0.31 0.26 -0.01 -0.27 -0.64 -0.15 60.26 55.95 59.77 79.55 74.13 81.77 31.58 28.29 39.00 -0.12 -0.24 0.16 -0.15 -0.22 0.28 0.39 0.51 0.88 MUSTER 34
35 GS−MetaServer2 59.69 56.38 56.70 79.11 74.35 81.90 18.09 15.35 -22.84 0.26 0.30 0.31 0.28 0.27 0.59 -0.27 -0.28 -0.78 59.69 56.38 56.70 79.11 74.35 81.90 26.64 24.78 22.12 -0.20 -0.18 -0.14 -0.20 -0.20 0.29 -0.12 0.06 0.17 GS−MetaServer2 35
36 GeneSilicoMetaServer 59.28 53.39 58.08 78.57 71.14 82.41 18.42 15.57 -21.28 0.22 0.06 0.43 0.24 0.07 0.63 -0.23 -0.25 -0.72 64.74 62.73 58.68 85.71 83.41 86.77 18.42 15.57 -21.28 0.51 0.66 0.05 0.61 0.76 0.77 -0.98 -1.11 -1.64 GeneSilicoMetaServer 36
37 BioSerf 58.96 51.09 60.93 77.71 68.04 77.14 27.96 18.86 14.86 0.19 -0.13 0.69 0.18 -0.12 0.27 0.97 0.22 0.62 58.96 51.09 60.93 77.71 68.04 77.14 27.96 18.86 14.86 -0.30 -0.87 0.28 -0.37 -0.86 -0.18 0.01 -0.69 -0.13 BioSerf 37
38 pro−sp3−TASSER 58.71 56.05 60.19 77.81 74.64 73.40 26.32 24.01 24.92 0.17 0.27 0.62 0.19 0.29 0.01 0.77 0.96 0.99 60.26 57.06 63.18 79.55 75.00 75.34 31.91 28.62 34.74 -0.12 -0.09 0.50 -0.15 -0.13 -0.36 0.43 0.55 0.70 pro−sp3−TASSER 38
39 Pcons_local 58.31 51.55 40.29 77.06 68.07 65.43 8.88 8.44 -37.13 0.14 -0.09 -1.17 0.14 -0.12 -0.54 -1.44 -1.27 -1.31 58.31 51.55 40.29 77.06 68.07 65.43 8.88 8.44 -36.90 -0.40 -0.81 -1.76 -0.45 -0.86 -1.34 -1.98 -2.02 -2.30 Pcons_local 39
40 Pcons_dot_net 58.31 51.55 40.29 77.06 68.07 65.43 8.88 8.44 -37.13 0.14 -0.09 -1.17 0.14 -0.12 -0.54 -1.44 -1.27 -1.31 66.37 64.96 78.28 86.69 85.53 88.11 41.12 38.49 49.58 0.75 0.95 1.99 0.73 0.98 0.90 1.39 1.81 1.32 Pcons_dot_net 40
41 CpHModels 57.09 52.71 45.44 74.67 64.50 67.10 19.08 16.45 -21.35 0.03 0.00 -0.71 -0.03 -0.34 -0.43 -0.15 -0.12 -0.72 57.09 52.71 45.44 74.67 64.50 67.10 19.08 16.45 -21.35 -0.57 -0.66 -1.25 -0.74 -1.24 -1.18 -0.91 -1.00 -1.65 CpHModels 41
42 FFASsuboptimal 54.23 52.39 50.61 71.21 69.12 65.18 20.39 17.43 9.55 -0.21 -0.03 -0.24 -0.26 -0.05 -0.56 0.02 0.02 0.42 54.23 52.39 50.61 71.21 69.12 65.18 20.39 17.43 9.55 -0.97 -0.70 -0.74 -1.17 -0.75 -1.37 -0.78 -0.88 -0.35 FFASsuboptimal 42
43 FFASstandard 54.23 52.28 51.47 71.75 68.94 65.78 20.72 18.09 11.94 -0.21 -0.03 -0.17 -0.23 -0.07 -0.52 0.06 0.11 0.51 54.23 52.28 51.47 71.75 68.94 65.78 20.72 18.09 11.94 -0.97 -0.72 -0.66 -1.10 -0.77 -1.31 -0.74 -0.79 -0.25 FFASstandard 43
44 FFASflextemplate 53.66 51.49 42.69 70.24 67.35 59.83 18.75 18.09 -6.88 -0.26 -0.10 -0.96 -0.33 -0.16 -0.93 -0.19 0.11 -0.19 53.99 51.49 43.40 70.24 68.18 60.80 21.05 18.09 -3.22 -1.01 -0.82 -1.45 -1.28 -0.85 -1.80 -0.71 -0.79 -0.89 FFASflextemplate 44
45 Fiser−M4T 52.77 49.35 28.62 70.02 63.67 53.66 5.59 4.93 -46.29 -0.34 -0.27 -2.23 -0.34 -0.39 -1.35 -1.85 -1.77 -1.65 52.77 49.35 28.62 70.02 63.67 53.66 5.59 4.93 -46.29 -1.18 -1.10 -2.91 -1.31 -1.32 -2.51 -2.32 -2.47 -2.69 Fiser−M4T 45
46 MULTICOM−CLUSTER 51.95 47.12 50.82 68.94 62.52 61.66 28.95 24.01 25.14 -0.41 -0.46 -0.23 -0.42 -0.47 -0.80 1.10 0.96 1.00 62.62 56.54 56.90 81.71 74.13 80.25 28.95 24.01 25.14 0.21 -0.16 -0.12 0.12 -0.22 0.13 0.12 -0.04 0.30 MULTICOM−CLUSTER 46
47 MUProt 50.90 45.58 46.04 67.53 60.82 60.18 21.38 16.34 9.51 -0.50 -0.58 -0.66 -0.51 -0.57 -0.90 0.14 -0.14 0.42 59.85 52.42 59.12 79.00 69.12 77.93 25.99 18.09 16.91 -0.18 -0.70 0.10 -0.21 -0.75 -0.10 -0.19 -0.79 -0.05 MUProt 47
48 MULTICOM−REFINE 50.65 46.69 45.93 67.21 59.42 60.11 21.38 16.56 9.28 -0.52 -0.49 -0.67 -0.53 -0.66 -0.91 0.14 -0.11 0.41 59.69 51.82 59.18 78.68 68.65 77.99 30.92 28.18 39.32 -0.20 -0.78 0.10 -0.25 -0.80 -0.10 0.32 0.49 0.89 MULTICOM−REFINE 48
49 MULTICOM−CMFR 50.65 44.44 45.87 67.21 60.28 59.91 21.05 16.01 9.75 -0.52 -0.67 -0.67 -0.53 -0.60 -0.92 0.10 -0.19 0.43 53.66 50.38 51.37 71.10 66.41 67.09 26.32 18.42 17.74 -1.06 -0.97 -0.67 -1.18 -1.03 -1.18 -0.16 -0.75 -0.01 MULTICOM−CMFR 49
50 FALCON 49.67 43.43 38.74 65.69 57.40 55.87 18.09 13.82 -8.38 -0.61 -0.76 -1.31 -0.64 -0.78 -1.20 -0.27 -0.50 -0.24 60.18 56.65 43.00 79.55 74.93 71.16 29.28 26.75 14.45 -0.13 -0.14 -1.49 -0.15 -0.14 -0.77 0.15 0.31 -0.15 FALCON 50
51 3Dpro 49.43 42.53 40.60 65.26 59.92 56.67 20.07 17.43 -2.76 -0.63 -0.83 -1.15 -0.67 -0.63 -1.14 -0.02 0.02 -0.03 61.73 53.91 53.59 81.39 71.14 77.42 25.99 22.92 18.07 0.09 -0.50 -0.45 0.08 -0.54 -0.15 -0.19 -0.18 0.00 3Dpro 51
52 MULTICOM−RANK 49.10 42.97 42.99 65.15 57.00 56.64 21.38 17.32 8.62 -0.66 -0.79 -0.93 -0.67 -0.81 -1.15 0.14 0.00 0.39 62.62 56.54 56.90 81.71 74.13 80.25 31.58 26.54 39.69 0.21 -0.16 -0.12 0.12 -0.22 0.13 0.39 0.28 0.91 MULTICOM−RANK 52
53 FUGUE_KM 47.80 45.03 26.62 62.99 59.31 46.49 14.47 12.06 -28.53 -0.77 -0.63 -2.41 -0.82 -0.67 -1.85 -0.73 -0.75 -0.99 47.80 45.03 26.62 62.99 59.31 46.49 24.67 23.14 8.05 -1.89 -1.67 -3.10 -2.17 -1.78 -3.22 -0.33 -0.15 -0.42 FUGUE_KM 53
54 Pcons_multi 44.62 35.75 48.73 58.98 46.72 65.31 22.04 19.08 1.90 -1.04 -1.38 -0.41 -1.09 -1.45 -0.55 0.22 0.25 0.14 58.31 51.55 50.30 77.06 68.07 67.11 23.03 19.08 5.52 -0.40 -0.81 -0.77 -0.45 -0.86 -1.18 -0.50 -0.67 -0.52 Pcons_multi 54
55 fais−server 43.24 32.74 51.53 57.47 42.97 67.79 22.37 12.83 5.96 -1.16 -1.63 -0.16 -1.20 -1.68 -0.38 0.27 -0.64 0.29 66.86 65.66 62.41 87.34 85.97 87.85 39.80 30.81 51.75 0.82 1.04 0.42 0.81 1.03 0.88 1.25 0.83 1.41 fais−server 55
56 mGenTHREADER 32.57 30.57 63.84 62.34 53.97 77.48 32.24 29.17 26.70 -2.08 -1.80 0.95 -0.87 -1.00 0.29 1.51 1.69 1.06 32.57 30.57 63.84 62.34 53.97 77.48 32.24 29.17 26.70 -4.04 -3.57 0.56 -2.25 -2.35 -0.15 0.46 0.62 0.36 mGenTHREADER 56
57 Distill 28.34 25.81 40.97 36.69 33.66 46.87 31.91 27.96 36.01 -2.45 -2.19 -1.11 -2.61 -2.26 -1.82 1.47 1.52 1.40 29.15 25.81 40.97 37.88 33.66 47.60 33.22 30.81 36.01 -4.53 -4.20 -1.69 -5.25 -4.49 -3.11 0.56 0.83 0.75 Distill 57
58 FEIG 23.37 20.28 36.82 31.17 27.06 40.12 32.57 30.59 41.17 -2.88 -2.64 -1.49 -2.99 -2.68 -2.28 1.56 1.90 1.59 65.88 64.47 76.98 86.15 84.78 86.15 53.29 42.76 52.37 0.68 0.88 1.86 0.66 0.90 0.71 2.65 2.35 1.44 FEIG 58
59 PSI 20.20 13.90 -3.29 26.84 18.47 11.87 14.14 10.86 -35.97 -3.15 -3.16 -5.10 -3.28 -3.21 -4.23 -0.77 -0.92 -1.26 60.18 56.65 45.03 79.55 74.93 71.16 29.28 26.75 14.45 -0.13 -0.14 -1.29 -0.15 -0.14 -0.77 0.15 0.31 -0.15 PSI 59
60 ACOMPMOD 18.57 14.93 11.81 24.46 19.70 17.51 23.36 18.53 12.66 -3.29 -3.08 -3.74 -3.44 -3.13 -3.84 0.39 0.17 0.54 18.57 14.93 12.28 24.46 19.70 19.01 30.26 27.74 28.96 -6.03 -5.62 -4.52 -6.89 -5.96 -5.94 0.25 0.44 0.46 ACOMPMOD 60
61 FOLDpro 16.12 13.46 18.64 21.43 17.89 27.07 23.36 21.38 7.83 -3.50 -3.20 -3.13 -3.65 -3.25 -3.18 0.39 0.58 0.36 20.11 17.67 23.78 26.62 23.38 30.42 28.29 25.22 21.25 -5.81 -5.26 -3.38 -6.62 -5.57 -4.81 0.05 0.12 0.14 FOLDpro 61
62 MUFOLD−MD 13.19 12.62 37.53 15.80 15.04 35.39 44.74 35.75 62.48 -3.75 -3.27 -1.42 -4.03 -3.43 -2.61 3.09 2.63 2.38 15.88 13.36 37.53 21.10 17.57 35.39 57.24 50.22 63.50 -6.41 -5.83 -2.03 -7.30 -6.18 -4.32 3.07 3.30 1.90 MUFOLD−MD 62
63 RBO−Proteus 12.62 10.18 31.08 16.23 14.94 31.88 42.10 33.11 46.00 -3.80 -3.47 -2.01 -4.00 -3.43 -2.85 2.76 2.25 1.77 14.25 11.59 31.45 16.23 14.94 32.22 42.10 33.11 47.48 -6.64 -6.06 -2.63 -7.90 -6.46 -4.63 1.49 1.12 1.23 RBO−Proteus 63
64 FALCON_CONSENSUS 12.46 11.48 7.70 16.45 15.30 12.16 28.95 26.75 14.45 -3.82 -3.36 -4.11 -3.99 -3.41 -4.21 1.10 1.35 0.60 60.18 56.65 43.00 79.55 74.93 71.16 29.28 26.75 14.45 -0.13 -0.14 -1.49 -0.15 -0.14 -0.77 0.15 0.31 -0.15 FALCON_CONSENSUS 64
65 LOOPP_Server 11.24 10.64 -9.95 14.72 13.82 -8.93 25.66 23.90 12.44 -3.92 -3.43 -5.71 -4.11 -3.50 -5.66 0.68 0.94 0.53 15.72 13.00 15.17 20.78 16.23 21.07 33.22 32.13 37.23 -6.43 -5.88 -4.23 -7.34 -6.32 -5.73 0.56 1.00 0.80 LOOPP_Server 65
66 mariner1 9.85 7.63 4.20 12.77 9.81 7.25 25.00 21.60 16.72 -4.04 -3.67 -4.43 -4.24 -3.75 -4.55 0.60 0.61 0.69 22.31 19.05 17.12 29.76 25.43 22.35 31.58 25.99 26.63 -5.50 -5.08 -4.04 -6.24 -5.35 -5.61 0.39 0.21 0.36 mariner1 66
67 RANDOM 9.52 8.30 9.52 12.39 10.83 12.39 26.96 22.46 26.96 -4.07 -3.62 -3.95 -4.26 -3.69 -4.19 0.85 0.74 1.07 9.52 8.30 9.52 12.39 10.83 12.39 26.96 22.46 26.96 -7.31 -6.50 -4.79 -8.37 -6.89 -6.59 -0.09 -0.24 0.37 RANDOM 67
68 schenk−torda−server 7.57 6.76 -4.64 10.28 8.98 -0.31 19.08 16.56 2.63 -4.24 -3.74 -5.23 -4.41 -3.80 -5.07 -0.15 -0.11 0.17 7.66 6.76 4.64 10.28 8.98 5.54 24.34 21.49 24.72 -7.58 -6.70 -5.27 -8.62 -7.09 -7.27 -0.36 -0.36 0.28 schenk−torda−server 68
69 BHAGEERATH                                                       -4.07 -3.62 -3.95 -4.26 -3.69 -4.19 0.85 0.74 1.07                                                       -7.31 -6.50 -4.79 -8.37 -6.89 -6.59 -0.09 -0.24 0.37 BHAGEERATH 69
70 Frankenstein                                                       -4.07 -3.62 -3.95 -4.26 -3.69 -4.19 0.85 0.74 1.07                                                       -7.31 -6.50 -4.79 -8.37 -6.89 -6.59 -0.09 -0.24 0.37 Frankenstein 70
71 huber−torda−server                                                       -4.07 -3.62 -3.95 -4.26 -3.69 -4.19 0.85 0.74 1.07                                                       -7.31 -6.50 -4.79 -8.37 -6.89 -6.59 -0.09 -0.24 0.37 huber−torda−server 71
72 mahmood−torda−server                                                       -4.07 -3.62 -3.95 -4.26 -3.69 -4.19 0.85 0.74 1.07                                                       -7.31 -6.50 -4.79 -8.37 -6.89 -6.59 -0.09 -0.24 0.37 mahmood−torda−server 72
73 pipe_int                                                       -4.07 -3.62 -3.95 -4.26 -3.69 -4.19 0.85 0.74 1.07                                                       -7.31 -6.50 -4.79 -8.37 -6.89 -6.59 -0.09 -0.24 0.37 pipe_int 73
74 test_http_server_01                                                       -4.07 -3.62 -3.95 -4.26 -3.69 -4.19 0.85 0.74 1.07                                                       -7.31 -6.50 -4.79 -8.37 -6.89 -6.59 -0.09 -0.24 0.37 test_http_server_01 74