T0458

Targets
387 388 389 390
391 392 393 394
395 396 397 398
399 400 401 402
403 404 405 406
407 408 409 410
411 412 413 414
415 416 417 418
419 420 421 422
423 424 425 426
427 428 429 430
431 432 433 434
435 436 437 438
439 440 441 442
443 444 445 446
447 448 449 450
451 452 453 454
455 456 457 458
459 460 461 462
463 464 465 466
467 468 469 470
471 472 473 474
475 476 477 478
479 480 481 482
483 484 485 486
487 488 489 490
491 492 493 494
495 496 497 498
499 500 501 502
503 504 505 506
507 508 509 510
511 512 513 514

T0458

protein SAV_2001 from Streptomyces avermitilis

Target type: Server only

Target sequence:

>T0458 SAV_2001, Streptomyces avermitilis, 107 residues
MVGAPRMTTPHTHRVQIEYCTQCRWLPRAAWLAQELLTTFETELTELALKPGTGGVFVVRVDDEVVWDRREQGFPEPTAVKRLVRDRVAPEKSLGHSERLEHHHHHH

Structure:
Method: X-ray, res=2.7Å, R/Rfree=0.23/0.26
Determined by: NESG
PDB ID: 3dex

3dex_A cartoon
Cartoon diagram of 458: 3dex chain A residues

PyMOL of 3dex

Domains:  PyMOL of domains

Single domain protein.

Structure classification:

Thioredoxin fold.

CASP category:

Comparative modeling:easy.

Closest templates:

2oka, 2fa8, 2p0g, 2ojl.

Target sequence - PDB file inconsistencies:

T0458    3dex.pdb    T0458.pdb    PyMOL    PyMOL of domains    

T0458    1 MVGAPRMTTPHTHRVQIEYCTQCRWLPRAAWLAQELLTTFETELTELALKPGTGGVFVVRVDDEVVWDRREQGFPEPTAVKRLVRDRVAPEKSLGHSERLEHHHHHH 107
           ~~~~~~~~~~|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~~~~~~~~~~~~
3dexA   11 ----------HTHRVQIEYCTQCRWLPRAAWLAQELLTTFETELTELALKPGTGGVFVVRVDDEVVWDRREQGFPEPTAVKRLVRDRVA------------------ 89

Single domain protein: target 11-89 ; pdb 11-89

Sequence classification:

Selenoprotein W-related family (Seleno_W_rel) in Pfam.

Server predictions:

T0458:pdb 11-89:seq 11-89:CM_easy;   alignment

distribution of first scores
First models for T0458: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

# GROUP ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ ↓ GROUP #
T0458 T0458 T0458 T0458
First score First Z-score Best score Best Z-score
1 MULTICOM−REFINE 96.83 88.40 93.21 0.62 -0.03 0.64 96.83 95.78 93.21 0.49 0.46 0.52 MULTICOM−REFINE 1
2 FFASstandard 96.83 87.97 92.62 0.62 -0.07 0.57 96.83 95.15 92.74 0.49 0.39 0.45 FFASstandard 2
3 Fiser−M4T 96.52 95.67 93.39 0.58 0.59 0.66 96.52 95.67 93.39 0.44 0.45 0.55 Fiser−M4T 3
4 FFASflextemplate 96.52 92.30 92.74 0.58 0.30 0.59 96.52 95.04 92.74 0.44 0.38 0.45 FFASflextemplate 4
5 FFASsuboptimal 96.52 92.30 92.74 0.58 0.30 0.59 97.15 96.31 93.23 0.54 0.52 0.52 FFASsuboptimal 5
6 Phyre_de_novo 96.20 95.78 92.02 0.54 0.60 0.50 96.20 95.78 92.02 0.39 0.46 0.34 Phyre_de_novo 6
7 GS−MetaServer2 96.20 95.78 92.20 0.54 0.60 0.52 96.20 95.78 92.20 0.39 0.46 0.37 GS−MetaServer2 7
8 GeneSilicoMetaServer 96.20 95.78 92.20 0.54 0.60 0.52 96.20 95.78 92.20 0.39 0.46 0.37 GeneSilicoMetaServer 8
9 HHpred4 96.20 95.78 92.18 0.54 0.60 0.52 96.20 95.78 92.18 0.39 0.46 0.37 HHpred4 9
10 HHpred5 96.20 95.78 93.43 0.54 0.60 0.67 96.20 95.78 93.43 0.39 0.46 0.55 HHpred5 10
11 FAMSD 96.20 95.78 91.98 0.54 0.60 0.50 96.20 95.78 91.98 0.39 0.46 0.33 FAMSD 11
12 BAKER−ROBETTA 96.20 95.36 91.53 0.54 0.56 0.45 96.20 95.36 91.98 0.39 0.41 0.33 BAKER−ROBETTA 12
13 LEE−SERVER 96.20 87.13 92.52 0.54 -0.14 0.56 96.20 95.57 92.52 0.39 0.44 0.42 LEE−SERVER 13
14 mGenTHREADER 95.89 95.46 92.57 0.50 0.57 0.57 95.89 95.46 92.57 0.34 0.43 0.42 mGenTHREADER 14
15 MULTICOM−CMFR 95.89 95.46 92.83 0.50 0.57 0.60 97.15 96.73 93.74 0.54 0.57 0.60 MULTICOM−CMFR 15
16 MULTICOM−CLUSTER 95.89 95.46 93.08 0.50 0.57 0.63 96.83 96.10 93.13 0.49 0.50 0.51 MULTICOM−CLUSTER 16
17 MUProt 95.89 95.46 92.56 0.50 0.57 0.57 96.52 96.10 92.94 0.44 0.50 0.48 MUProt 17
18 pipe_int 95.89 95.46 91.85 0.50 0.57 0.48 96.52 95.46 92.28 0.44 0.43 0.38 pipe_int 18
19 SAM−T08−server 95.89 94.41 92.21 0.50 0.48 0.53 95.89 94.83 92.21 0.34 0.36 0.37 SAM−T08−server 19
20 HHpred2 95.89 91.25 92.01 0.50 0.21 0.50 95.89 91.25 92.01 0.34 -0.04 0.34 HHpred2 20
21 MULTICOM−RANK 95.57 95.15 91.41 0.47 0.54 0.43 95.57 95.15 92.05 0.29 0.39 0.35 MULTICOM−RANK 21
22 Pcons_local 95.57 95.15 91.40 0.47 0.54 0.43 95.89 95.46 91.99 0.34 0.43 0.34 Pcons_local 22
23 PS2−server 95.57 95.15 92.07 0.47 0.54 0.51 95.89 95.15 93.01 0.34 0.39 0.49 PS2−server 23
24 Pcons_dot_net 95.57 95.15 91.40 0.47 0.54 0.43 95.89 95.46 91.99 0.34 0.43 0.34 Pcons_dot_net 24
25 Pcons_multi 95.57 95.15 91.40 0.47 0.54 0.43 96.83 95.99 93.40 0.49 0.48 0.55 Pcons_multi 25
26 RAPTOR 95.57 95.15 91.55 0.47 0.54 0.45 95.89 95.15 92.18 0.34 0.39 0.37 RAPTOR 26
27 circle 95.57 94.73 91.32 0.47 0.51 0.42 95.57 94.73 91.32 0.29 0.34 0.24 circle 27
28 3Dpro 95.57 94.52 91.91 0.47 0.49 0.49 95.89 95.04 92.39 0.34 0.38 0.40 3Dpro 28
29 BioSerf 95.57 93.46 91.49 0.47 0.40 0.44 95.57 93.46 91.49 0.29 0.20 0.26 BioSerf 29
30 Zhang−Server 95.25 95.04 92.46 0.43 0.53 0.55 95.89 95.04 92.69 0.34 0.38 0.44 Zhang−Server 30
31 3DShot2 95.25 94.83 91.64 0.43 0.52 0.46 95.25 94.83 91.64 0.24 0.36 0.28 3DShot2 31
32 FALCON 95.25 94.62 90.54 0.43 0.50 0.33 95.25 94.62 90.54 0.24 0.33 0.12 FALCON 32
33 SAM−T06−server 95.25 94.62 92.60 0.43 0.50 0.57 95.25 94.62 92.60 0.24 0.33 0.43 SAM−T06−server 33
34 YASARA 94.94 94.73 90.96 0.39 0.51 0.38 94.94 94.73 91.59 0.19 0.34 0.28 YASARA 34
35 FEIG 94.94 94.52 91.67 0.39 0.49 0.46 96.83 95.04 92.76 0.49 0.38 0.45 FEIG 35
36 LOOPP_Server 94.94 94.52 91.62 0.39 0.49 0.46 97.47 95.99 93.21 0.59 0.48 0.52 LOOPP_Server 36
37 PSI 94.94 94.52 91.64 0.39 0.49 0.46 95.89 95.04 92.26 0.34 0.38 0.38 PSI 37
38 forecast 94.94 94.52 91.08 0.39 0.49 0.40 95.57 94.52 91.67 0.29 0.32 0.29 forecast 38
39 MUSTER 94.94 94.52 91.40 0.39 0.49 0.43 96.20 95.78 92.27 0.39 0.46 0.38 MUSTER 39
40 GS−KudlatyPred 94.62 94.20 91.45 0.35 0.46 0.44 97.15 94.20 92.91 0.54 0.29 0.48 GS−KudlatyPred 40
41 Poing 94.30 93.67 89.96 0.31 0.42 0.27 94.62 93.67 90.33 0.14 0.23 0.09 Poing 41
42 Phyre2 94.30 93.67 89.96 0.31 0.42 0.27 94.62 93.67 90.33 0.14 0.23 0.09 Phyre2 42
43 Phragment 94.30 93.67 89.96 0.31 0.42 0.27 94.62 93.67 90.33 0.14 0.23 0.09 Phragment 43
44 fais−server 94.30 93.46 91.33 0.31 0.40 0.42 96.83 95.25 92.63 0.49 0.40 0.43 fais−server 44
45 Pushchino 93.67 93.04 90.70 0.24 0.36 0.35 93.67 93.04 90.70 -0.01 0.16 0.14 Pushchino 45
46 nFOLD3 92.41 91.35 86.97 0.09 0.22 -0.08 95.89 95.46 92.57 0.34 0.43 0.42 nFOLD3 46
47 panther_server 92.09 90.19 84.46 0.05 0.12 -0.37 94.30 93.88 88.50 0.09 0.25 -0.19 panther_server 47
48 keasar−server 91.77 87.97 84.27 0.01 -0.07 -0.39 96.52 95.67 93.13 0.44 0.45 0.51 keasar−server 48
49 3D−JIGSAW_AEP 91.46 91.03 88.69 -0.03 0.19 0.12 93.67 91.03 90.63 -0.01 -0.07 0.13 3D−JIGSAW_AEP 49
50 pro−sp3−TASSER 91.14 90.72 89.53 -0.07 0.16 0.22 95.57 92.93 92.15 0.29 0.15 0.36 pro−sp3−TASSER 50
51 COMA−M 91.14 86.50 83.54 -0.07 -0.20 -0.47 91.14 86.50 83.54 -0.41 -0.57 -0.94 COMA−M 51
52 SAM−T02−server 90.82 82.17 83.25 -0.10 -0.57 -0.50 91.77 85.65 84.02 -0.31 -0.66 -0.87 SAM−T02−server 52
53 CpHModels 90.19 89.56 83.83 -0.18 0.06 -0.44 90.19 89.56 83.83 -0.56 -0.23 -0.89 CpHModels 53
54 COMA 90.19 66.98 82.37 -0.18 -1.87 -0.61 90.19 66.98 83.54 -0.56 -2.73 -0.94 COMA 54
55 3D−JIGSAW_V3 89.56 88.92 89.50 -0.26 0.01 0.21 96.83 95.36 92.02 0.49 0.41 0.34 3D−JIGSAW_V3 55
56 METATASSER 82.28 79.75 80.05 -1.13 -0.77 -0.87 93.35 89.77 89.58 -0.06 -0.21 -0.03 METATASSER 56
57 rehtnap 75.63 72.26 69.36 -1.93 -1.41 -2.10 76.27 74.16 83.34 -2.77 -1.94 -0.97 rehtnap 57
58 Distill 75.32 66.25 65.40 -1.96 -1.93 -2.56 75.32 66.56 66.63 -2.93 -2.78 -3.49 Distill 58
59 FALCON_CONSENSUS 73.73 66.77 77.78 -2.15 -1.88 -1.13 81.65 78.06 78.34 -1.92 -1.50 -1.72 FALCON_CONSENSUS 59
60 FUGUE_KM 68.04 56.86 62.78 -2.84 -2.73 -2.86 68.04 56.86 62.78 -4.08 -3.85 -4.07 FUGUE_KM 60
61 ACOMPMOD 67.41 53.90 61.24 -2.91 -2.98 -3.04 67.41 53.90 61.24 -4.18 -4.18 -4.30 ACOMPMOD 61
62 FOLDpro 66.77 56.22 63.51 -2.99 -2.79 -2.78 94.94 94.52 91.70 0.19 0.32 0.29 FOLDpro 62
63 Frankenstein 61.39 45.78 57.56 -3.64 -3.68 -3.46 61.39 45.78 57.56 -5.14 -5.08 -4.86 Frankenstein 63
64 MUFOLD−MD 43.99 38.92 56.77 -5.72 -4.27 -3.55 44.30 41.03 56.77 -7.85 -5.61 -4.98 MUFOLD−MD 64
65 RBO−Proteus 33.86 29.96 44.64 -6.94 -5.03 -4.95 35.76 29.96 45.35 -9.21 -6.84 -6.70 RBO−Proteus 65
66 MUFOLD−Server 31.65 23.42 36.90 -7.20 -5.59 -5.84 38.29 33.02 38.17 -8.81 -6.50 -7.78 MUFOLD−Server 66
67 mariner1 29.75 24.89 33.17 -7.43 -5.47 -6.27 33.86 27.95 36.59 -9.51 -7.06 -8.02 mariner1 67
68 OLGAFS 28.48 27.21 24.82 -7.58 -5.27 -7.23 94.62 91.67 90.35 0.14 0.01 0.09 OLGAFS 68
69 BHAGEERATH 26.27 26.27 32.50 -7.85 -5.35 -6.34 26.90 26.27 33.47 -10.62 -7.25 -8.49 BHAGEERATH 69
70 RANDOM 25.10 20.23 25.10 -7.99 -5.86 -7.19 25.10 20.23 25.10 -10.90 -7.92 -9.76 RANDOM 70
71 huber−torda−server 0.00 0.00 -10.43 -11.00 -7.59 -11.28 0.00 0.00 -10.43 -14.89 -10.16 -15.12 huber−torda−server 71
72 mahmood−torda−server                   -7.99 -5.86 -7.19                   -10.90 -7.92 -9.76 mahmood−torda−server 72
73 schenk−torda−server                   -7.99 -5.86 -7.19                   -10.90 -7.92 -9.76 schenk−torda−server 73
74 test_http_server_01                   -7.99 -5.86 -7.19                   -10.90 -7.92 -9.76 test_http_server_01 74