T0490

Targets
387 388 389 390
391 392 393 394
395 396 397 398
399 400 401 402
403 404 405 406
407 408 409 410
411 412 413 414
415 416 417 418
419 420 421 422
423 424 425 426
427 428 429 430
431 432 433 434
435 436 437 438
439 440 441 442
443 444 445 446
447 448 449 450
451 452 453 454
455 456 457 458
459 460 461 462
463 464 465 466
467 468 469 470
471 472 473 474
475 476 477 478
479 480 481 482
483 484 485 486
487 488 489 490
491 492 493 494
495 496 497 498
499 500 501 502
503 504 505 506
507 508 509 510
511 512 513 514

T0490

conserved exported protein BeR141 from Bordetella pertussis

Target type: Server only

Target sequence:

>T0490 BeR141, Bordetella pertussis, 369 residues
MSTDIDCIVIGAGVVGLAIARALAAGGHEVLVAEAAEGIGTGTSSRNSEVIHAGIYYPADSLKARLCVRGKHLLYEYCAARGVPHQRLGKLIVATSDAEASQLDSIARRAGANGVDDLQHIDGAAARRLEPALHCTAALVSPSTGIVDSHALMLAYQGDAESDGAQLVFHTPLIAGRVRPEGGFELDFGGAEPMTLSCRVLINAAGLHAPGLARRIEGIPRDSIPPEYLCKGSYFTLAGRAPFSRLIYPVPQHAGLGVHLTLDLGGQAKFGPDTEWIATEDYTLDPRRADVFYAAVRSYWPALPDGALAPGYTGIRPKISGPHEPAADFAIAGPASHGVAGLVNLYGIESPGLTASLAIAEETLARLAA

Structure:
Method: X-ray, res=1.7Å, R/Rfree=0.19/0.22
Determined by: NESG
PDB ID: 3dme

3dme_A cartoon
Cartoon diagram of 490: 3dme chain A

PyMOL of 3dme

Domains:  PyMOL of domains

Four domains. Residue ranges in PDB: 3-49,148-228,318-368; 50-88,143-147; 89-142 and 229-317. Residue ranges in target: 3-49,148-228,318-368; 50-88,143-147; 89-142 and 229-317.

490 domain evaluation plot
Correlation between weighted by the number of residues sum of GDT-TS scores for domain-based evlatuation (y, vertical axis) and whole chain GDT-TS (x, horizontal axis).

To compute the weighted sum, GDT-TS for each domain was multiplied by the domain length, and this sum was divided by the sum of domain lengths. Each point represents first server model. Green, gray and black points are top 10, bottom 25% and the rest of prediction models. Blue line is the best-fit slope line (intersection 0) to the top 10 server models. Red line is the diagonal. Slope and root mean square y-x distance for the top 10 models (average difference between the weighted sum of domain GDT-TS scores and the whole chain GDT-TS score) are shown above the plot.

Structure classification:

N-domain has FAD/NAD(P)-binding domain Rossmann-like fold. C-domain has FAD-linked reductases, C-terminal domain fold.

3dme_A cartoon
Ribbon diagram of 490: 3dme chain A

CASP category:

Whole chain: Comparative modeling:medium.

1st domain: Comparative modeling:medium. 2nd domain: Comparative modeling:easy. 3rd domain: Comparative modeling:easy. 4th domain: Comparative modeling:medium.

Closest templates:

2gag, 1y56, 1pj5, 1ryi, 2gf3.

Target sequence - PDB file inconsistencies:

T0490    3dme.pdb    T0490.pdb    PyMOL    PyMOL of domains    

T0490    1 MSTDIDCIVIGAGVVGLAIARALAAGGHEVLVAEAAEGIGTGTSSRNSEVIHAGIYYPADSLKARLCVRGKHLLYEYCAARGVPHQRLGKLIVATSDAEASQLDSIARRAGANGVDDLQHIDGAAARRLEPALHCTAALVSPSTGIVDSHALMLAYQGDAESDGAQLVFHTPLIAGRVRPEGGFELDFGGAEPMTLSCRVLINAAGLHAPGLARRIEGIPRDSIPPEYLCKGSYFTLAGRAPFSRLIYPVPQHAGLGVHLTLDLGGQAKFGPDTEWIATEDYTLDPRRADVFYAAVRSYWPALPDGALAPGYTGIRPKISGPHEPAADFAIAGPASHGVAGLVNLYGIESPGLTASLAIAEETLARLAA 369
           ~~||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~
3dmeA    3 --TDIDCIVIGAGVVGLAIARALAAGGHEVLVAEAAEGIGTGTSSRNSEVIHAGIYYPADSLKARLCVRGKHLLYEYCAARGVPHQRLGKLIVATSDAEASQLDSIARRAGANGVDDLQHIDGAAARRLEPALHCTAALVSPSTGIVDSHALMLAYQGDAESDGAQLVFHTPLIAGRVRPEGGFELDFGGAEPMTLSCRVLINAAGLHAPGLARRIEGIPRDSIPPEYLCKGSYFTLAGRAPFSRLIYPVPQHAGLGVHLTLDLGGQAKFGPDTEWIATEDYTLDPRRADVFYAAVRSYWPALPDGALAPGYTGIRPKISGPHEPAADFAIAGPASHGVAGLVNLYGIESPGLTASLAIAEETLARLA- 368

We suggest to evaluate this target as a single domain spanning whole chain. However, evolutionarily this is a 4-domain protein:

1st domain: target 3-49, 148-228, 318-368 ; pdb 3-49, 148-228, 318-368

2nd domain: target 50-88, 143-147 ; pdb 50-88, 143-147

3rd domain: target 89-142 ; pdb 89-142

4th domain: target 229-317 ; pdb 229-317

Sequence classification:

FAD dependent oxidoreductase family (DAO) in Pfam.

Server predictions:

T0490:pdb 3-368:seq 3-368:CM_medium;   alignment

distribution of first scores
First models for T0490: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

490_1:pdb 3-49,148-228,318-368:seq 3-49,148-228,318-368:CM_medium;   alignment

distribution of first scores
First models for T0490_1: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

490_2:pdb 50-88,143-147:seq 50-88,143-147:CM_easy;   alignment

distribution of first scores
First models for T0490_2: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

490_3:pdb 89-142:seq 89-142:CM_easy;   alignment

distribution of first scores
First models for T0490_3: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

490_4:pdb 229-317:seq 229-317:CM_medium;   alignment

distribution of first scores
First models for T0490_4: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

# GROUP ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ ↓ GROUP #
T0490 490_1 490_2 490_3 490_4 T0490 490_1 490_2 490_3 490_4 T0490 490_1 490_2 490_3 490_4 T0490 490_1 490_2 490_3 490_4
First score First Z-score Best score Best Z-score
1 LEE−SERVER 73.43 65.96 74.95 82.40 73.84 81.92 79.55 72.35 81.55 90.28 87.19 90.45 70.22 61.98 68.68 1.51 1.70 1.34 1.60 1.54 1.59 0.65 0.73 1.18 1.05 1.12 0.95 0.75 0.61 0.67 73.43 65.96 74.95 82.40 77.23 81.92 80.68 75.19 81.55 90.28 87.19 90.45 73.03 66.85 72.37 1.43 1.54 1.28 1.65 1.83 1.74 0.53 0.71 1.03 0.84 0.82 0.82 1.15 1.07 0.87 LEE−SERVER 1
2 HHpred5 70.90 63.52 72.94 79.05 66.71 79.85 82.95 74.24 79.89 90.74 86.73 88.20 69.10 57.49 66.98 1.16 1.35 1.13 1.05 0.34 1.31 1.05 0.90 0.99 1.09 1.09 0.81 0.64 0.16 0.52 70.90 63.52 72.94 79.05 66.71 79.85 82.95 74.24 79.89 90.74 86.73 88.20 69.10 57.49 66.98 1.05 1.17 1.04 0.99 -0.05 1.37 0.89 0.58 0.80 0.88 0.78 0.64 0.47 -0.40 0.18 HHpred5 2
3 Zhang−Server 70.83 64.87 70.96 78.63 69.88 76.74 82.95 77.65 78.97 82.41 78.09 84.21 68.82 63.95 69.13 1.15 1.54 0.91 0.98 0.88 0.89 1.05 1.23 0.88 0.43 0.53 0.56 0.61 0.81 0.71 70.90 64.87 71.51 78.91 72.21 77.28 84.09 77.65 79.57 83.80 81.33 84.72 69.66 63.95 70.63 1.05 1.38 0.87 0.96 0.93 0.92 1.07 1.04 0.76 0.20 0.36 0.35 0.56 0.61 0.65 Zhang−Server 3
4 RAPTOR 70.70 61.41 73.18 79.47 71.83 80.64 78.98 71.78 77.38 86.11 78.39 85.27 71.35 66.29 70.89 1.13 1.05 1.15 1.12 1.20 1.42 0.58 0.67 0.69 0.72 0.55 0.63 0.87 1.05 0.87 70.70 61.41 73.18 79.47 71.83 80.64 84.66 78.79 80.67 90.28 88.43 90.07 71.91 67.79 72.75 1.02 0.85 1.07 1.07 0.86 1.51 1.16 1.19 0.91 0.84 0.92 0.79 0.95 1.21 0.92 RAPTOR 4
5 Phyre_de_novo 70.22 61.91 71.10 77.37 69.93 74.69 81.82 73.48 82.24 86.57 84.72 84.25 73.31 65.82 71.91 1.06 1.12 0.93 0.77 0.88 0.62 0.92 0.83 1.26 0.76 0.96 0.56 1.07 1.00 0.96 70.22 61.91 71.10 77.37 69.93 74.69 81.82 73.48 82.24 92.13 90.89 90.29 73.31 65.82 71.91 0.94 0.92 0.82 0.66 0.52 0.46 0.71 0.48 1.12 1.02 1.11 0.81 1.20 0.90 0.81 Phyre_de_novo 5
6 HHpred2 69.74 61.45 72.94 78.77 72.53 78.57 81.25 73.30 78.54 86.11 82.72 85.96 70.51 63.95 68.63 1.00 1.06 1.13 1.00 1.32 1.14 0.85 0.82 0.83 0.72 0.83 0.67 0.78 0.81 0.67 69.74 61.45 72.94 78.77 72.53 78.57 81.25 73.30 78.54 86.11 82.72 85.96 70.51 63.95 68.63 0.87 0.85 1.04 0.94 0.99 1.15 0.62 0.46 0.62 0.43 0.47 0.45 0.71 0.61 0.39 HHpred2 6
7 METATASSER 69.33 62.05 69.86 76.82 71.32 73.36 83.52 78.60 78.53 87.96 85.49 84.19 68.26 63.76 67.75 0.94 1.14 0.79 0.68 1.12 0.44 1.12 1.32 0.83 0.87 1.01 0.56 0.55 0.79 0.59 71.31 65.60 72.74 78.63 75.65 76.95 83.52 78.60 80.53 88.89 87.35 88.30 70.79 66.48 70.14 1.11 1.49 1.01 0.91 1.55 0.86 0.98 1.16 0.89 0.70 0.83 0.64 0.76 1.01 0.58 METATASSER 7
8 FEIG 68.99 59.11 68.27 73.74 67.13 69.29 81.25 73.67 79.58 87.04 79.63 87.08 68.54 63.30 67.93 0.89 0.73 0.62 0.18 0.41 -0.11 0.85 0.85 0.95 0.79 0.63 0.74 0.58 0.75 0.60 69.26 60.20 69.23 77.23 73.14 74.31 81.25 74.05 79.58 87.04 85.49 87.08 68.54 63.30 71.33 0.79 0.66 0.59 0.63 1.10 0.40 0.62 0.56 0.76 0.52 0.68 0.54 0.37 0.51 0.74 FEIG 8
9 COMA−M 68.78 59.49 70.39 76.12 72.21 72.64 81.25 74.05 78.91 87.04 83.33 86.83 70.51 65.08 67.26 0.86 0.78 0.85 0.57 1.27 0.34 0.85 0.89 0.87 0.79 0.87 0.72 0.78 0.93 0.54 69.88 61.77 70.62 76.12 72.21 72.87 83.52 78.60 79.70 87.96 86.42 88.37 72.75 68.82 69.60 0.89 0.90 0.76 0.41 0.93 0.14 0.98 1.16 0.77 0.61 0.76 0.65 1.10 1.37 0.51 COMA−M 9
10 BioSerf 68.78 59.09 73.39 78.63 70.44 78.87 81.82 71.97 79.01 80.09 65.89 81.11 72.75 67.88 73.35 0.86 0.72 1.17 0.98 0.97 1.18 0.92 0.69 0.88 0.25 -0.27 0.37 1.01 1.21 1.09 68.78 59.09 73.39 78.63 70.44 78.87 81.82 71.97 79.01 80.09 65.89 81.11 72.75 67.88 73.35 0.72 0.49 1.09 0.91 0.61 1.20 0.71 0.28 0.68 -0.16 -0.86 0.04 1.10 1.23 1.00 BioSerf 10
11 MULTICOM−RANK 68.58 58.70 68.66 76.82 65.36 73.57 77.27 67.05 73.65 79.17 65.89 79.70 69.66 60.67 69.57 0.84 0.67 0.66 0.68 0.12 0.47 0.38 0.22 0.26 0.17 -0.27 0.28 0.69 0.48 0.75 68.58 62.00 68.66 76.82 68.16 73.57 78.98 71.40 74.46 80.56 70.99 81.57 69.66 60.67 70.52 0.69 0.94 0.52 0.55 0.20 0.27 0.26 0.20 0.06 -0.11 -0.46 0.08 0.56 0.10 0.63 MULTICOM−RANK 11
12 MULTICOM−CLUSTER 68.58 58.70 68.66 76.82 65.36 73.57 77.27 67.05 73.65 79.17 65.89 79.70 69.66 60.67 69.57 0.84 0.67 0.66 0.68 0.12 0.47 0.38 0.22 0.26 0.17 -0.27 0.28 0.69 0.48 0.75 69.19 61.27 70.13 77.37 68.16 74.50 86.93 83.52 80.81 87.04 84.57 87.61 69.94 63.20 70.73 0.78 0.82 0.70 0.66 0.20 0.43 1.51 1.82 0.93 0.52 0.61 0.59 0.61 0.49 0.66 MULTICOM−CLUSTER 12
13 PS2−server 68.51 59.04 70.36 77.65 71.97 76.72 81.82 75.76 78.96 86.11 83.03 84.71 66.01 56.46 62.26 0.83 0.72 0.84 0.82 1.23 0.89 0.92 1.05 0.88 0.72 0.85 0.59 0.32 0.05 0.10 68.51 59.04 70.36 77.79 71.97 78.23 81.82 75.76 78.96 86.11 83.03 84.71 68.54 62.73 66.96 0.68 0.48 0.73 0.74 0.89 1.09 0.71 0.78 0.67 0.43 0.49 0.35 0.37 0.42 0.17 PS2−server 13
14 MUProt 67.96 58.99 68.32 76.40 63.83 73.18 76.14 67.42 73.17 79.63 67.90 79.68 68.54 61.05 69.63 0.75 0.71 0.62 0.61 -0.14 0.42 0.24 0.26 0.20 0.21 -0.14 0.28 0.58 0.52 0.76 67.96 61.57 68.41 76.40 67.36 73.29 76.14 67.42 73.34 79.63 70.68 79.68 68.82 63.58 69.94 0.60 0.87 0.49 0.47 0.06 0.22 -0.18 -0.33 -0.10 -0.20 -0.48 -0.07 0.42 0.55 0.56 MUProt 14
15 pro−sp3−TASSER 67.90 61.38 67.28 76.82 68.20 73.93 80.68 75.76 75.15 85.65 81.94 86.61 65.17 57.87 59.91 0.74 1.05 0.51 0.68 0.59 0.52 0.78 1.05 0.43 0.68 0.78 0.71 0.24 0.20 -0.11 72.20 65.96 72.87 79.33 75.23 77.32 83.52 79.36 80.86 91.67 90.43 88.32 70.79 65.36 70.08 1.24 1.54 1.03 1.04 1.47 0.93 0.98 1.27 0.93 0.98 1.07 0.65 0.76 0.83 0.57 pro−sp3−TASSER 15
16 COMA 67.83 58.54 69.71 73.88 67.18 71.65 83.52 78.60 79.29 84.72 79.78 84.36 71.63 60.39 68.74 0.73 0.65 0.77 0.20 0.42 0.21 1.12 1.32 0.92 0.61 0.64 0.57 0.89 0.45 0.68 67.83 58.54 70.62 73.88 69.74 72.87 83.52 78.60 79.70 85.65 81.02 88.37 71.63 65.54 69.60 0.58 0.41 0.76 -0.02 0.49 0.14 0.98 1.16 0.77 0.39 0.33 0.65 0.91 0.86 0.51 COMA 16
17 Pcons_dot_net 67.62 59.29 68.09 75.56 68.30 73.81 80.68 69.70 77.99 85.19 79.94 85.37 66.57 59.27 65.29 0.70 0.75 0.60 0.47 0.61 0.50 0.78 0.48 0.76 0.65 0.65 0.63 0.38 0.34 0.37 67.62 59.29 68.09 75.56 70.76 73.81 82.39 75.95 79.37 87.96 84.57 88.12 66.85 62.08 65.77 0.54 0.52 0.45 0.30 0.67 0.31 0.80 0.81 0.73 0.61 0.61 0.63 0.08 0.32 0.02 Pcons_dot_net 17
18 Pcons_multi 67.62 58.99 68.01 75.84 62.24 73.39 81.25 74.81 79.09 85.65 80.40 85.26 67.14 62.08 65.49 0.70 0.71 0.59 0.52 -0.41 0.44 0.85 0.96 0.89 0.68 0.68 0.63 0.44 0.62 0.39 67.62 58.99 68.01 75.84 70.76 73.92 82.39 75.95 79.74 87.04 83.33 87.18 67.14 62.08 65.77 0.54 0.47 0.45 0.36 0.67 0.33 0.80 0.81 0.78 0.52 0.51 0.55 0.13 0.32 0.02 Pcons_multi 18
19 MUSTER 67.49 59.84 68.20 76.12 71.00 73.94 81.82 70.45 78.81 83.80 80.71 84.02 66.85 62.17 65.72 0.68 0.83 0.61 0.57 1.06 0.52 0.92 0.55 0.86 0.54 0.70 0.55 0.41 0.63 0.41 67.76 59.84 68.53 76.95 72.77 77.94 81.82 72.16 78.81 84.26 80.71 84.02 70.51 65.64 71.05 0.56 0.60 0.51 0.58 1.03 1.04 0.71 0.30 0.65 0.25 0.31 0.29 0.71 0.88 0.70 MUSTER 19
20 MULTICOM−REFINE 67.35 60.38 68.17 75.28 66.99 72.76 76.70 67.61 73.43 79.63 70.06 79.30 68.54 59.36 69.88 0.66 0.91 0.61 0.43 0.39 0.36 0.31 0.28 0.23 0.21 0.00 0.26 0.58 0.35 0.78 67.83 60.75 68.33 77.23 66.99 73.22 76.70 67.99 73.50 80.09 73.15 79.68 68.82 63.20 69.88 0.58 0.74 0.48 0.63 -0.00 0.21 -0.10 -0.25 -0.08 -0.16 -0.29 -0.07 0.42 0.49 0.55 MULTICOM−REFINE 20
21 nFOLD3 67.21 57.92 70.15 76.26 70.67 76.83 82.95 76.14 79.97 83.80 79.17 85.24 66.29 61.42 65.55 0.65 0.56 0.82 0.59 1.01 0.91 1.05 1.08 1.00 0.54 0.60 0.62 0.35 0.56 0.39 67.21 58.27 70.15 76.26 70.67 76.83 82.95 76.14 79.97 88.43 84.41 86.52 67.42 61.42 66.36 0.48 0.36 0.70 0.44 0.65 0.84 0.89 0.84 0.81 0.66 0.60 0.50 0.18 0.21 0.10 nFOLD3 21
22 3DShot2 66.80 57.74 67.54 75.28 68.95 73.46 80.68 69.70 78.71 80.09 75.15 80.98 67.14 61.89 64.88 0.59 0.53 0.54 0.43 0.72 0.45 0.78 0.48 0.85 0.25 0.33 0.36 0.44 0.60 0.33 66.80 57.74 67.54 75.28 68.95 73.46 80.68 69.70 78.71 80.09 75.15 80.98 67.14 61.89 64.88 0.42 0.28 0.39 0.25 0.35 0.25 0.53 -0.02 0.64 -0.16 -0.13 0.03 0.13 0.29 -0.10 3DShot2 22
23 Pcons_local 66.80 57.70 67.41 74.44 64.20 72.51 76.14 66.29 76.96 84.72 80.09 86.44 66.57 62.08 64.47 0.59 0.53 0.52 0.29 -0.08 0.33 0.24 0.15 0.64 0.61 0.66 0.70 0.38 0.62 0.29 67.62 59.29 68.09 75.56 68.30 74.50 80.68 72.73 77.99 87.96 84.57 86.59 66.57 62.08 65.29 0.54 0.52 0.45 0.30 0.23 0.43 0.53 0.38 0.54 0.61 0.61 0.50 0.03 0.32 -0.04 Pcons_local 23
24 LOOPP_Server 66.39 56.01 66.85 76.68 66.71 76.74 73.30 68.75 68.00 82.41 79.63 82.68 63.76 54.03 59.10 0.53 0.29 0.46 0.66 0.34 0.89 -0.09 0.39 -0.40 0.43 0.63 0.47 0.09 -0.19 -0.19 66.39 56.01 68.19 76.95 73.05 76.74 73.30 68.75 68.00 82.41 79.63 82.68 68.26 61.14 71.81 0.35 0.02 0.47 0.58 1.08 0.82 -0.63 -0.15 -0.83 0.07 0.22 0.18 0.32 0.17 0.80 LOOPP_Server 24
25 FAMSD 66.19 56.81 66.18 74.30 67.13 71.93 80.11 70.64 76.79 78.70 67.59 81.23 67.42 57.68 64.10 0.50 0.40 0.39 0.27 0.41 0.25 0.71 0.56 0.63 0.14 -0.16 0.38 0.46 0.18 0.26 66.19 56.81 66.18 74.72 67.13 72.76 80.11 71.02 76.99 80.56 74.54 81.23 67.42 59.83 64.39 0.32 0.14 0.22 0.14 0.02 0.12 0.44 0.15 0.40 -0.11 -0.18 0.05 0.18 -0.03 -0.16 FAMSD 25
26 MULTICOM−CMFR 65.71 58.67 65.74 74.16 65.41 72.46 72.73 60.61 63.28 79.17 71.14 79.61 65.45 49.34 67.07 0.44 0.67 0.34 0.24 0.12 0.32 -0.16 -0.38 -0.95 0.17 0.07 0.28 0.26 -0.67 0.53 65.71 58.67 65.74 74.16 65.41 72.46 72.73 60.80 63.81 79.17 71.14 80.37 65.45 49.34 67.07 0.25 0.43 0.17 0.03 -0.29 0.07 -0.72 -1.21 -1.41 -0.25 -0.45 -0.02 -0.17 -1.68 0.19 MULTICOM−CMFR 26
27 3D−JIGSAW_V3 65.71 57.79 67.67 76.26 62.66 73.98 78.41 52.27 78.25 74.07 68.52 70.11 68.54 63.11 68.01 0.44 0.54 0.55 0.59 -0.34 0.52 0.51 -1.17 0.80 -0.23 -0.10 -0.31 0.58 0.73 0.61 65.78 57.79 67.67 76.26 68.34 73.98 78.41 73.67 78.37 74.07 69.44 70.18 68.54 63.11 68.01 0.26 0.29 0.40 0.44 0.24 0.34 0.17 0.51 0.59 -0.75 -0.58 -0.87 0.37 0.48 0.31 3D−JIGSAW_V3 27
28 3D−JIGSAW_AEP 65.44 58.42 68.17 75.00 69.88 73.90 79.55 68.56 75.08 77.31 69.91 80.09 70.51 66.20 67.93 0.40 0.63 0.61 0.38 0.88 0.51 0.65 0.37 0.43 0.03 -0.01 0.31 0.78 1.04 0.60 65.78 58.45 68.20 75.14 70.06 73.90 80.11 69.89 75.14 77.78 70.37 80.09 70.51 66.20 67.95 0.26 0.39 0.47 0.22 0.54 0.32 0.44 0.00 0.15 -0.38 -0.51 -0.04 0.71 0.96 0.30 3D−JIGSAW_AEP 28
29 HHpred4 65.44 54.96 70.95 76.82 70.39 77.66 81.25 78.22 80.70 84.26 79.01 85.09 66.85 60.11 65.27 0.40 0.14 0.91 0.68 0.96 1.02 0.85 1.28 1.08 0.58 0.59 0.61 0.41 0.42 0.37 65.44 54.96 70.95 76.82 70.39 77.66 81.25 78.22 80.70 84.26 79.01 85.09 66.85 60.11 65.27 0.21 -0.14 0.80 0.55 0.60 0.99 0.62 1.11 0.91 0.25 0.17 0.38 0.08 0.01 -0.04 HHpred4 29
30 CpHModels 65.30 56.69 64.93 70.39 64.15 67.28 77.27 70.83 76.05 86.11 82.41 86.51 66.85 61.61 64.51 0.38 0.39 0.25 -0.37 -0.09 -0.38 0.38 0.58 0.54 0.72 0.81 0.70 0.41 0.58 0.30 65.30 56.69 64.93 70.39 64.15 67.28 77.27 70.83 76.05 86.11 82.41 86.51 66.85 61.61 64.51 0.19 0.12 0.07 -0.71 -0.51 -0.84 -0.01 0.13 0.27 0.43 0.44 0.50 0.08 0.24 -0.14 CpHModels 30
31 keasar−server 65.30 56.47 65.23 75.56 67.74 73.53 79.55 73.48 77.62 81.02 75.77 83.71 61.80 52.25 54.18 0.38 0.35 0.29 0.47 0.52 0.46 0.65 0.83 0.72 0.32 0.37 0.53 -0.11 -0.37 -0.63 65.30 56.47 65.73 75.70 71.56 73.96 80.11 75.95 79.29 81.48 78.39 83.71 62.08 53.46 56.86 0.19 0.09 0.17 0.33 0.81 0.34 0.44 0.81 0.72 -0.02 0.12 0.26 -0.75 -1.03 -1.13 keasar−server 31
32 circle 65.03 56.28 67.40 74.16 68.67 72.39 79.55 71.59 72.06 87.50 84.72 88.49 65.17 58.24 64.13 0.34 0.33 0.52 0.24 0.67 0.31 0.65 0.65 0.07 0.83 0.96 0.82 0.24 0.23 0.26 67.08 60.02 67.47 75.14 69.65 73.25 81.82 71.59 79.15 87.50 84.72 88.49 68.26 63.02 65.13 0.46 0.63 0.38 0.22 0.47 0.21 0.71 0.23 0.70 0.57 0.62 0.66 0.32 0.47 -0.06 circle 32
33 BAKER−ROBETTA 64.82 57.04 64.87 73.32 62.15 70.87 78.98 69.13 76.98 81.02 75.46 81.84 67.14 59.64 64.81 0.31 0.43 0.25 0.11 -0.42 0.10 0.58 0.42 0.65 0.32 0.35 0.41 0.44 0.38 0.33 65.64 57.31 65.90 74.02 66.20 72.30 81.25 72.16 80.06 81.94 75.46 83.51 67.14 60.95 65.06 0.24 0.22 0.19 0.00 -0.15 0.04 0.62 0.30 0.82 0.02 -0.11 0.25 0.13 0.14 -0.07 BAKER−ROBETTA 33
34 GS−KudlatyPred 64.82 57.04 64.87 73.32 62.15 70.87 78.98 69.13 76.98 81.02 75.46 81.84 67.14 59.64 64.81 0.31 0.43 0.25 0.11 -0.42 0.10 0.58 0.42 0.65 0.32 0.35 0.41 0.44 0.38 0.33 64.82 57.04 64.87 73.32 62.15 70.87 78.98 69.13 76.98 81.02 75.46 81.84 67.14 59.64 64.81 0.11 0.18 0.07 -0.13 -0.87 -0.21 0.26 -0.10 0.40 -0.07 -0.11 0.11 0.13 -0.06 -0.10 GS−KudlatyPred 34
35 SAM−T02−server 64.62 56.28 62.91 71.65 62.34 66.38 77.84 70.64 74.32 77.78 71.61 81.06 66.57 61.70 63.09 0.28 0.33 0.03 -0.17 -0.39 -0.50 0.45 0.56 0.34 0.06 0.10 0.37 0.38 0.59 0.17 64.62 58.42 62.91 72.35 70.06 66.38 77.84 70.64 74.32 82.41 78.24 83.78 66.57 61.70 63.77 0.08 0.39 -0.17 -0.33 0.54 -1.00 0.08 0.10 0.04 0.07 0.11 0.27 0.03 0.26 -0.24 SAM−T02−server 35
36 FFASflextemplate 64.14 54.58 64.55 73.60 62.15 71.78 80.11 74.43 79.76 78.70 74.38 81.27 62.08 53.84 56.97 0.22 0.09 0.21 0.15 -0.42 0.23 0.71 0.92 0.97 0.14 0.28 0.38 -0.08 -0.21 -0.38 65.37 54.80 64.71 74.72 69.04 72.49 81.25 74.81 79.76 81.48 77.78 83.12 62.64 55.52 57.08 0.20 -0.17 0.05 0.14 0.36 0.08 0.62 0.66 0.78 -0.02 0.08 0.21 -0.66 -0.71 -1.10 FFASflextemplate 36
37 fais−server 63.25 55.01 64.00 69.83 65.08 68.65 66.48 45.27 68.53 90.74 89.81 90.18 60.95 57.40 63.17 0.09 0.15 0.15 -0.47 0.07 -0.19 -0.90 -1.84 -0.34 1.09 1.29 0.93 -0.20 0.15 0.18 66.67 58.15 68.54 75.14 67.88 74.11 80.68 75.00 80.34 90.74 89.81 90.18 66.01 59.74 65.80 0.40 0.35 0.51 0.22 0.15 0.36 0.53 0.68 0.86 0.88 1.03 0.80 -0.07 -0.05 0.02 fais−server 37
38 SAM−T08−server 62.64 53.12 65.05 74.44 67.92 72.73 76.70 71.40 75.33 85.19 79.63 85.63 62.08 55.90 55.72 0.01 -0.12 0.27 0.29 0.55 0.35 0.31 0.64 0.46 0.65 0.63 0.65 -0.08 -0.00 -0.49 62.77 55.19 65.94 74.44 67.92 72.73 76.70 71.40 75.33 85.19 79.63 85.63 66.01 59.27 64.66 -0.20 -0.11 0.20 0.09 0.16 0.12 -0.10 0.20 0.18 0.34 0.22 0.42 -0.07 -0.12 -0.12 SAM−T08−server 38
39 SAM−T06−server 62.64 52.34 64.36 72.63 67.22 71.11 57.95 48.86 62.05 82.87 77.01 82.81 65.73 60.86 64.32 0.01 -0.23 0.19 -0.01 0.43 0.14 -1.91 -1.50 -1.09 0.47 0.46 0.47 0.29 0.50 0.28 62.98 55.87 64.36 72.63 67.97 71.11 75.00 69.32 69.93 82.87 77.01 82.81 65.73 60.86 64.32 -0.17 -0.00 0.01 -0.27 0.17 -0.17 -0.36 -0.07 -0.57 0.11 0.02 0.19 -0.12 0.13 -0.17 SAM−T06−server 39
40 GeneSilicoMetaServer 62.36 53.44 62.58 72.35 64.43 68.85 78.41 70.08 75.97 88.43 83.18 88.17 57.02 51.40 52.89 -0.03 -0.07 -0.00 -0.05 -0.04 -0.17 0.51 0.51 0.53 0.90 0.86 0.80 -0.60 -0.46 -0.74 68.58 59.29 70.39 75.56 66.34 73.38 79.55 72.73 76.38 88.43 83.18 88.17 70.22 63.48 68.59 0.69 0.52 0.73 0.30 -0.12 0.23 0.35 0.38 0.32 0.66 0.50 0.63 0.66 0.54 0.38 GeneSilicoMetaServer 40
41 Frankenstein 62.16 53.55 66.65 73.60 65.97 72.27 78.41 75.76 72.82 87.50 84.72 88.91 63.20 57.58 63.57 -0.06 -0.06 0.44 0.15 0.22 0.29 0.51 1.05 0.16 0.83 0.96 0.85 0.03 0.17 0.21 65.10 57.22 68.23 73.60 65.97 72.99 81.25 77.08 75.40 90.28 88.12 89.76 65.17 57.58 64.37 0.16 0.20 0.47 -0.08 -0.19 0.16 0.62 0.96 0.18 0.84 0.89 0.77 -0.22 -0.39 -0.16 Frankenstein 41
42 FALCON_CONSENSUS 61.34 48.00 61.22 69.69 63.73 63.62 59.66 51.33 62.23 87.50 84.11 85.47 66.01 61.70 65.75 -0.17 -0.84 -0.15 -0.49 -0.16 -0.87 -1.71 -1.26 -1.07 0.83 0.92 0.64 0.32 0.59 0.41 65.50 56.94 64.88 71.23 65.41 68.51 81.82 74.43 74.23 87.96 84.88 85.58 67.14 61.89 65.75 0.22 0.16 0.07 -0.54 -0.29 -0.62 0.71 0.61 0.02 0.61 0.64 0.42 0.13 0.29 0.02 FALCON_CONSENSUS 42
43 GS−MetaServer2 60.79 53.01 60.43 72.77 65.88 71.78 71.59 68.56 61.97 70.83 60.65 66.72 57.87 52.06 52.50 -0.25 -0.14 -0.24 0.02 0.20 0.23 -0.29 0.37 -1.10 -0.48 -0.61 -0.52 -0.51 -0.39 -0.78 68.58 59.29 70.39 75.56 66.95 73.38 79.55 72.73 75.89 85.19 81.17 86.53 70.22 63.48 68.59 0.69 0.52 0.73 0.30 -0.01 0.23 0.35 0.38 0.25 0.34 0.34 0.50 0.66 0.54 0.38 GS−MetaServer2 43
44 pipe_int 59.97 49.00 59.70 72.91 62.29 70.79 69.32 57.58 68.34 53.70 37.35 40.02 68.26 63.58 72.81 -0.36 -0.70 -0.31 0.04 -0.40 0.09 -0.56 -0.67 -0.36 -1.83 -2.14 -2.17 0.55 0.78 1.04 59.97 49.00 59.70 72.91 62.29 70.79 69.32 57.58 68.34 53.70 37.35 40.02 68.26 63.58 72.81 -0.63 -1.06 -0.56 -0.22 -0.85 -0.22 -1.26 -1.64 -0.78 -2.74 -3.12 -3.38 0.32 0.55 0.93 pipe_int 44
45 PSI 59.90 51.37 60.49 69.13 58.89 67.95 67.61 47.92 68.87 87.50 82.25 85.83 53.93 47.00 52.88 -0.37 -0.37 -0.23 -0.58 -0.97 -0.29 -0.77 -1.58 -0.30 0.83 0.80 0.66 -0.91 -0.90 -0.74 66.80 56.97 67.43 76.26 70.95 74.69 80.68 73.11 78.38 87.50 82.25 85.83 67.42 58.24 69.56 0.42 0.16 0.38 0.44 0.70 0.46 0.53 0.43 0.59 0.57 0.43 0.44 0.18 -0.28 0.51 PSI 45
46 forecast 59.77 53.44 56.02 68.58 64.39 65.04 76.70 66.48 69.42 78.24 76.08 76.90 50.00 38.95 48.02 -0.39 -0.07 -0.72 -0.67 -0.05 -0.68 0.31 0.17 -0.23 0.10 0.39 0.11 -1.31 -1.72 -1.18 60.52 54.46 59.53 72.07 67.83 69.92 76.70 67.61 69.42 82.87 76.08 79.98 60.95 52.90 57.18 -0.55 -0.22 -0.58 -0.38 0.15 -0.38 -0.10 -0.30 -0.64 0.11 -0.06 -0.05 -0.95 -1.12 -1.09 forecast 46
47 Poing 59.49 48.57 59.99 75.98 65.27 74.02 67.61 53.60 69.08 53.70 35.49 41.43 64.61 58.61 68.15 -0.43 -0.76 -0.28 0.54 0.10 0.53 -0.77 -1.05 -0.27 -1.83 -2.26 -2.08 0.18 0.27 0.62 61.41 53.71 60.64 75.98 65.27 74.02 67.61 59.47 69.08 92.13 90.89 90.29 65.73 62.17 68.86 -0.41 -0.34 -0.44 0.39 -0.31 0.35 -1.53 -1.39 -0.68 1.02 1.11 0.81 -0.12 0.33 0.42 Poing 47
48 FALCON 59.43 50.87 55.36 70.81 63.36 63.92 69.89 61.93 55.53 72.69 62.50 67.86 58.43 48.88 51.43 -0.44 -0.44 -0.79 -0.30 -0.22 -0.83 -0.50 -0.26 -1.85 -0.34 -0.49 -0.45 -0.45 -0.71 -0.87 65.50 56.94 64.88 71.23 65.41 68.51 81.82 74.43 74.23 87.96 84.88 85.58 67.14 61.89 65.75 0.22 0.16 0.07 -0.54 -0.29 -0.62 0.71 0.61 0.02 0.61 0.64 0.42 0.13 0.29 0.02 FALCON 48
49 Phyre2 59.43 48.63 59.91 75.70 67.04 74.24 67.05 49.62 67.22 53.70 36.11 42.31 64.61 58.24 68.40 -0.44 -0.76 -0.29 0.50 0.40 0.56 -0.83 -1.42 -0.49 -1.83 -2.22 -2.03 0.18 0.23 0.65 61.54 53.16 60.66 75.70 67.04 74.24 67.61 59.47 69.00 92.13 90.89 90.29 66.85 60.86 69.38 -0.39 -0.42 -0.44 0.33 0.00 0.38 -1.53 -1.39 -0.69 1.02 1.11 0.81 0.08 0.13 0.48 Phyre2 49
50 Phragment 59.29 50.14 59.64 75.56 65.88 73.88 67.05 49.24 67.22 53.24 38.73 42.22 64.61 58.24 68.40 -0.46 -0.54 -0.32 0.47 0.20 0.51 -0.83 -1.46 -0.49 -1.87 -2.04 -2.03 0.18 0.23 0.65 61.54 53.76 61.02 75.56 65.88 73.88 67.61 59.47 69.00 92.13 90.89 90.29 66.85 60.86 69.38 -0.39 -0.33 -0.40 0.30 -0.20 0.32 -1.53 -1.39 -0.69 1.02 1.11 0.81 0.08 0.13 0.48 Phragment 50
51 FFASstandard 58.06 49.95 56.96 74.86 64.71 71.29 65.34 61.93 61.33 44.91 36.88 37.92 67.14 57.96 70.91 -0.63 -0.57 -0.61 0.36 0.01 0.16 -1.04 -0.26 -1.18 -2.53 -2.17 -2.30 0.44 0.21 0.87 58.13 49.95 56.96 75.14 64.71 72.08 65.34 61.93 61.33 51.85 39.04 50.06 68.54 64.05 70.91 -0.91 -0.91 -0.89 0.22 -0.41 0.00 -1.88 -1.06 -1.75 -2.92 -2.98 -2.55 0.37 0.63 0.68 FFASstandard 51
52 FFASsuboptimal 57.51 49.02 57.10 74.30 67.50 71.41 65.34 53.98 65.12 43.98 36.57 36.36 67.14 59.46 70.85 -0.71 -0.70 -0.60 0.27 0.48 0.18 -1.04 -1.01 -0.73 -2.60 -2.19 -2.39 0.44 0.36 0.87 58.47 50.00 58.05 74.58 67.50 71.41 67.61 62.12 65.30 43.98 36.57 38.39 69.66 64.23 73.77 -0.86 -0.91 -0.75 0.11 0.09 -0.11 -1.53 -1.04 -1.20 -3.69 -3.18 -3.52 0.56 0.66 1.05 FFASsuboptimal 52
53 MUFOLD−Server 57.10 48.41 55.31 67.88 59.59 63.18 59.66 47.92 62.26 72.22 63.89 70.52 61.80 54.68 58.71 -0.76 -0.79 -0.79 -0.79 -0.85 -0.93 -1.71 -1.58 -1.07 -0.37 -0.40 -0.28 -0.11 -0.13 -0.22 57.17 48.43 55.31 67.88 59.59 63.19 77.27 68.56 69.47 72.22 63.89 70.52 61.80 54.68 58.71 -1.06 -1.15 -1.08 -1.20 -1.33 -1.56 -0.01 -0.18 -0.63 -0.93 -1.02 -0.84 -0.80 -0.84 -0.89 MUFOLD−Server 53
54 mGenTHREADER 56.63 49.84 53.01 74.16 63.73 70.29 58.52 48.30 45.01 44.91 38.73 33.91 64.89 57.96 67.44 -0.83 -0.58 -1.04 0.24 -0.16 0.03 -1.84 -1.55 -3.08 -2.53 -2.04 -2.54 0.21 0.21 0.56 56.63 49.84 53.01 74.16 63.73 70.29 58.52 48.30 45.01 44.91 38.73 33.91 64.89 57.96 67.44 -1.14 -0.93 -1.36 0.03 -0.59 -0.31 -2.96 -2.88 -3.98 -3.60 -3.01 -3.89 -0.26 -0.33 0.23 mGenTHREADER 54
55 Fiser−M4T 53.35 46.20 55.02 68.58 61.13 68.55 74.43 52.84 73.41 77.31 68.36 78.16 30.34 23.41 28.90 -1.29 -1.10 -0.82 -0.67 -0.59 -0.21 0.04 -1.12 0.23 0.03 -0.11 0.19 -3.32 -3.29 -2.89 53.35 46.20 55.02 68.58 61.13 68.55 74.43 52.84 73.41 77.31 68.36 78.16 30.34 23.41 28.90 -1.64 -1.49 -1.12 -1.07 -1.05 -0.62 -0.45 -2.27 -0.09 -0.43 -0.67 -0.20 -6.26 -5.74 -4.73 Fiser−M4T 55
56 Distill 51.98 44.24 46.02 51.68 45.90 43.43 73.86 70.83 67.50 71.30 61.73 69.27 58.99 52.06 55.55 -1.48 -1.38 -1.80 -3.44 -3.15 -3.59 -0.03 0.58 -0.46 -0.45 -0.54 -0.36 -0.40 -0.39 -0.51 52.12 44.24 47.70 52.65 45.90 43.88 76.70 71.40 73.46 80.56 77.16 73.66 60.11 53.56 56.79 -1.83 -1.79 -2.00 -4.19 -3.78 -4.95 -0.10 0.20 -0.08 -0.11 0.03 -0.58 -1.09 -1.02 -1.14 Distill 56
57 FUGUE_KM 49.45 42.76 44.92 64.39 58.71 56.15 65.91 58.71 65.68 70.83 62.81 65.59 37.64 32.02 27.97 -1.83 -1.59 -1.92 -1.36 -1.00 -1.88 -0.97 -0.56 -0.67 -0.48 -0.47 -0.59 -2.57 -2.42 -2.98 61.00 52.48 58.19 70.67 67.22 65.61 73.30 68.37 68.46 85.19 84.26 83.60 62.36 53.18 64.95 -0.47 -0.52 -0.74 -0.65 0.04 -1.13 -0.63 -0.20 -0.77 0.34 0.59 0.25 -0.70 -1.08 -0.09 FUGUE_KM 57
58 panther_server 49.45 40.21 46.38 64.25 56.89 57.84 44.89 40.72 42.15 48.15 40.12 36.51 64.33 58.33 63.43 -1.83 -1.95 -1.76 -1.38 -1.31 -1.65 -3.46 -2.27 -3.41 -2.27 -1.95 -2.38 0.15 0.24 0.20 53.62 41.05 49.73 73.74 60.38 69.52 62.50 52.65 45.39 66.67 61.73 62.45 67.42 61.61 68.66 -1.60 -2.28 -1.76 -0.05 -1.19 -0.45 -2.33 -2.30 -3.93 -1.47 -1.19 -1.51 0.18 0.24 0.39 panther_server 58
59 huber−torda−server 46.99 39.98 43.68 62.71 55.59 58.94 71.59 68.18 59.86 68.06 58.49 63.79 22.47 20.04 18.83 -2.17 -1.98 -2.06 -1.63 -1.52 -1.50 -0.29 0.33 -1.35 -0.70 -0.75 -0.70 -4.12 -3.63 -3.80 56.15 48.57 49.79 70.67 60.06 65.98 77.84 74.43 71.35 78.24 72.38 72.18 64.89 59.08 65.50 -1.22 -1.12 -1.75 -0.65 -1.24 -1.07 0.08 0.61 -0.37 -0.34 -0.35 -0.70 -0.26 -0.15 -0.02 huber−torda−server 59
60 ACOMPMOD 45.42 37.59 45.81 56.70 52.14 50.60 66.48 49.81 70.91 93.06 90.59 89.44 21.63 18.26 25.66 -2.39 -2.32 -1.83 -2.62 -2.10 -2.62 -0.90 -1.41 -0.06 1.27 1.34 0.88 -4.21 -3.81 -3.19 51.02 44.79 51.87 67.74 63.73 67.39 72.16 66.48 70.91 93.06 90.59 89.44 62.64 54.96 69.36 -2.00 -1.70 -1.50 -1.23 -0.59 -0.82 -0.81 -0.45 -0.43 1.11 1.09 0.74 -0.66 -0.80 0.48 ACOMPMOD 60
61 rehtnap 42.90 34.77 32.29 58.38 53.63 49.97 41.48 36.55 31.75 46.30 35.19 34.51 46.07 41.01 27.87 -2.74 -2.72 -3.30 -2.34 -1.85 -2.71 -3.86 -2.66 -4.62 -2.42 -2.28 -2.51 -1.71 -1.51 -2.99 42.90 36.95 32.29 58.38 53.63 49.97 41.48 36.55 31.93 46.30 35.19 34.51 46.35 41.01 27.97 -3.25 -2.91 -3.86 -3.07 -2.40 -3.88 -5.64 -4.45 -5.78 -3.47 -3.29 -3.84 -3.48 -2.98 -4.85 rehtnap 61
62 OLGAFS 38.73 31.40 31.71 43.85 33.19 37.92 55.68 40.91 58.25 48.61 41.82 33.57 49.16 40.36 42.22 -3.32 -3.19 -3.36 -4.73 -5.29 -4.33 -2.18 -2.25 -1.53 -2.24 -1.84 -2.57 -1.40 -1.58 -1.70 38.93 31.60 31.71 43.85 34.40 37.92 56.82 41.10 58.25 48.61 41.82 34.99 49.72 41.48 42.23 -3.86 -3.73 -3.93 -5.92 -5.84 -6.00 -3.22 -3.84 -2.17 -3.24 -2.76 -3.80 -2.90 -2.91 -3.01 OLGAFS 62
63 mariner1 31.63 25.80 32.53 49.86 40.08 51.38 31.82 29.55 23.34 34.72 30.71 29.79 38.48 29.12 37.07 -4.31 -3.99 -3.27 -3.74 -4.13 -2.52 -5.01 -3.32 -5.60 -3.33 -2.57 -2.80 -2.49 -2.71 -2.16 31.63 25.80 32.53 50.42 44.18 51.38 43.75 41.86 36.56 48.15 35.49 38.35 38.48 31.74 37.07 -4.97 -4.62 -3.83 -4.63 -4.09 -3.64 -5.28 -3.74 -5.14 -3.29 -3.26 -3.52 -4.85 -4.44 -3.68 mariner1 63
64 FOLDpro 13.93 12.32 14.72 27.65 23.28 27.90 28.98 25.38 24.70 21.30 17.59 18.27 17.14 14.61 18.56 -6.78 -5.89 -5.21 -7.39 -6.95 -5.68 -5.34 -3.72 -5.44 -4.39 -3.43 -3.51 -4.67 -4.18 -3.82 28.82 24.55 31.59 54.19 45.53 53.71 50.00 40.15 42.31 40.28 38.43 35.89 18.82 16.39 19.58 -5.40 -4.81 -3.94 -3.89 -3.84 -3.23 -4.30 -3.97 -4.36 -4.06 -3.03 -3.73 -8.26 -6.84 -5.93 FOLDpro 64
65 Pushchino 13.05 10.34 8.52 21.23 18.16 14.45 36.93 31.25 29.00 25.93 23.77 21.00 16.29 15.07 16.43 -6.90 -6.17 -5.88 -8.44 -7.81 -7.49 -4.40 -3.16 -4.94 -4.02 -3.02 -3.34 -4.75 -4.14 -4.01 13.05 10.34 8.52 21.23 18.16 14.45 36.93 31.25 29.00 25.93 23.77 21.00 16.29 15.07 16.43 -7.82 -6.99 -6.72 -10.36 -8.74 -10.13 -6.35 -5.16 -6.18 -5.46 -4.19 -4.97 -8.70 -7.05 -6.33 Pushchino 65
66 RBO−Proteus 11.61 10.34 27.59 21.93 19.13 37.69 43.18 35.98 44.61 41.20 39.04 44.64 20.79 18.91 29.26 -7.11 -6.17 -3.81 -8.33 -7.65 -4.36 -3.66 -2.71 -3.12 -2.82 -2.02 -1.88 -4.29 -3.75 -2.86 11.61 10.93 27.62 22.21 20.95 37.69 43.18 38.83 46.29 41.20 39.97 45.21 24.44 23.32 29.92 -8.04 -6.90 -4.42 -10.17 -8.24 -6.04 -5.37 -4.14 -3.81 -3.97 -2.91 -2.95 -7.29 -5.76 -4.60 RBO−Proteus 66
67 3Dpro 11.54 9.90 14.54 22.35 19.18 27.56 25.00 21.21 19.34 25.46 19.29 27.75 14.89 13.67 14.77 -7.12 -6.24 -5.23 -8.26 -7.64 -5.72 -5.81 -4.11 -6.07 -4.06 -3.31 -2.92 -4.90 -4.28 -4.16 36.88 28.41 37.38 49.30 44.04 52.37 61.93 49.43 56.71 65.28 57.56 62.36 21.91 18.35 25.94 -4.17 -4.22 -3.24 -4.85 -4.11 -3.46 -2.42 -2.73 -2.38 -1.61 -1.52 -1.52 -7.73 -6.54 -5.11 3Dpro 67
68 MUFOLD−MD 11.07 9.34 3.27 19.83 18.81 1.35 56.25 46.40 51.19 65.74 54.01 59.95 0.00 0.00 -11.66 -7.18 -6.32 -6.45 -8.67 -7.70 -9.25 -2.11 -1.73 -2.36 -0.89 -1.05 -0.94 -6.41 -5.66 -6.53 12.16 10.34 3.27 20.53 18.81 1.67 60.80 55.87 53.42 67.13 55.86 59.95 0.00 0.00 -11.66 -7.96 -6.99 -7.35 -10.50 -8.63 -12.38 -2.60 -1.87 -2.83 -1.43 -1.65 -1.72 -11.53 -9.41 -9.95 MUFOLD−MD 68
69 RANDOM 6.96 5.98 6.96 13.32 11.15 13.32 38.03 33.83 38.03 29.21 24.13 29.21 19.51 16.99 19.51 -7.75 -6.79 -6.05 -9.74 -8.99 -7.64 -4.27 -2.92 -3.89 -3.76 -3.00 -2.83 -4.42 -3.94 -3.74 6.96 5.98 6.96 13.32 11.15 13.32 38.03 33.83 38.03 29.21 24.13 29.21 19.51 16.99 19.51 -8.76 -7.66 -6.90 -11.91 -10.00 -10.33 -6.18 -4.81 -4.94 -5.14 -4.16 -4.29 -8.14 -6.75 -5.94 RANDOM 69
70 schenk−torda−server 5.33 4.67 6.56 9.22 7.68 11.77 25.57 21.97 11.76 33.80 30.40 24.31 16.29 13.67 20.15 -7.98 -6.98 -6.10 -10.41 -9.57 -7.85 -5.75 -4.04 -6.95 -3.40 -2.59 -3.14 -4.75 -4.28 -3.68 5.94 5.21 8.34 9.50 8.38 12.08 35.80 31.63 25.96 33.80 30.40 28.47 17.42 15.73 22.30 -8.91 -7.78 -6.74 -12.66 -10.49 -10.55 -6.53 -5.11 -6.60 -4.69 -3.66 -4.35 -8.51 -6.95 -5.58 schenk−torda−server 70
71 BHAGEERATH                                                                                           -7.75 -6.79 -6.05 -9.74 -8.99 -7.64 -4.27 -2.92 -3.89 -3.76 -3.00 -2.83 -4.42 -3.94 -3.74                                                                                           -8.76 -7.66 -6.90 -11.91 -10.00 -10.33 -6.18 -4.81 -4.94 -5.14 -4.16 -4.29 -8.14 -6.75 -5.94 BHAGEERATH 71
72 YASARA                                                                                           -7.75 -6.79 -6.05 -9.74 -8.99 -7.64 -4.27 -2.92 -3.89 -3.76 -3.00 -2.83 -4.42 -3.94 -3.74                                                                                           -8.76 -7.66 -6.90 -11.91 -10.00 -10.33 -6.18 -4.81 -4.94 -5.14 -4.16 -4.29 -8.14 -6.75 -5.94 YASARA 72
73 mahmood−torda−server                                                                                           -7.75 -6.79 -6.05 -9.74 -8.99 -7.64 -4.27 -2.92 -3.89 -3.76 -3.00 -2.83 -4.42 -3.94 -3.74                                                                                           -8.76 -7.66 -6.90 -11.91 -10.00 -10.33 -6.18 -4.81 -4.94 -5.14 -4.16 -4.29 -8.14 -6.75 -5.94 mahmood−torda−server 73
74 test_http_server_01                                                                                           -7.75 -6.79 -6.05 -9.74 -8.99 -7.64 -4.27 -2.92 -3.89 -3.76 -3.00 -2.83 -4.42 -3.94 -3.74                                                                                           -8.76 -7.66 -6.90 -11.91 -10.00 -10.33 -6.18 -4.81 -4.94 -5.14 -4.16 -4.29 -8.14 -6.75 -5.94 test_http_server_01 74