T0510

Targets
387 388 389 390
391 392 393 394
395 396 397 398
399 400 401 402
403 404 405 406
407 408 409 410
411 412 413 414
415 416 417 418
419 420 421 422
423 424 425 426
427 428 429 430
431 432 433 434
435 436 437 438
439 440 441 442
443 444 445 446
447 448 449 450
451 452 453 454
455 456 457 458
459 460 461 462
463 464 465 466
467 468 469 470
471 472 473 474
475 476 477 478
479 480 481 482
483 484 485 486
487 488 489 490
491 492 493 494
495 496 497 498
499 500 501 502
503 504 505 506
507 508 509 510
511 512 513 514

T0510

Fibrinogen binding protein from Staphylococcus aureus

Target type: Server only

Target sequence:

>T0510 Fibrinogen binding protein, Staphylococcus aureus, 288 residues
MAYDGLFTKKMVESLQFLTTGRVHKINQPDNDTILMVVRQNRQNHQLLLSIHPNFSRLQLTTKKYDNPFNPPMFARVFRKHLEGGIIESIKQIGNDRRIEIDIKSKDEIGDTIYRTVILEIMGKHSNLILVDENRKIIEGFKHLTPNTNHYRTVMPGFNYEAPPTQHKINPYDITGAEVLKYIDFNAGNIAKQLLNQFEGFSPLITNEIVSRRQFMTSSTLPEAFDEVMAETKLPPTPIFHKNHETGKEDFYFIKLNQFNDDTVTYDSLNDLLDRFYDARGERERVKQ

Structure:
Method: X-ray, res=2.81Å, R/Rfree=0.19/0.27
Determined by: MCSG
PDB ID: 3doa

3doa cartoon
Cartoon diagram of 510: 3doa

3doa cartoon
Ribbon diagram of 510: 3doa

PyMOL of 3doa

Domains:  PyMOL of domains

Three domains. Residue ranges in PDB: 1-165; 166-235 and 236-279. Residue ranges in target:1-165; 166-235 and 236-279.

510 domain evaluation plot
Correlation between weighted by the number of residues sum of GDT-TS scores for domain-based evlatuation (y, vertical axis) and whole chain GDT-TS (x, horizontal axis).

To compute the weighted sum, GDT-TS for each domain was multiplied by the domain length, and this sum was divided by the sum of domain lengths. Each point represents first server model. Green, gray and black points are top 10, bottom 25% and the rest of prediction models. Blue line is the best-fit slope line (intersection 0) to the top 10 server models. Red line is the diagonal. Slope and root mean square y-x distance for the top 10 models (average difference between the weighted sum of domain GDT-TS scores and the whole chain GDT-TS score) are shown above the plot.

Structure classification:

N-domain: N-terminal domain of MutM-like DNA repair proteins fold.

Middle domain: S13-like H2TH domain fold.

C-domain: deteriorated treble-clef finger with Glucocorticoid receptor-like (DNA-binding domain) fold.

N and C-domains experience amazing structural transformations compared to homologous protein MutM. Apparently, T0510 and MutM are homologous throughout the chain in all three domains, and even relative positions of these domains appears very similar:

3doa cartoon
Cartoon diagram of 510: 3doa

1ee8_A cartoon
Cartoon diagram of MutM: 1ee8 chain A

3doa cartoon
Cartoon diagram of 510 domains: 3doa, N-, middle and C-domains
are shown in blue, green and red, respectively
 

1ee8_A cartoon
Cartoon diagram of MutM domains: 1ee8_A, N-, middle and C-domains
are shown in blue, green and red, respectively,
Zn ion is shown as a white ball.

However, closer look at the N-domains reveals large topological differences. The view of N-domain is "from the back" compared to the images above:

3doa N-domain
N-domain of 510: 3doa residues 1-165

1ee8_A N-domain
N-domain of MutM: 1ee8 chain A residues 1-121

Architecture appears similar between the two proteins: two β-sheets flanked by 2 α-helices on the sides, but topology is quite different. The β-sheet facing the viewer is N-terminal (blue-cyan-green) in T0510, and is inserted in the middle of the molecule (yellow-orange) in MutM. Common superimposable parts of both molecules are shown in green below, different insertions are colored red and blue.

3doa N-domain
N-domain of 510: 3doa residues 1-165
insertion close to the N-terminus is red

1ee8_A N-domain
N-domain of MutM: 1ee8 chain A residues 1-121
insertion in the middle of the domain is blue

T0510 has a 3-stranded insertion (red) after the N-terminal α-helix, and MutM has a 3-stranded insertion (blue) after the 4th common β-strand. Although both insertions form 3-stranded antiparallel β-sheets, they are different in topology: meander in T0510, and βLββ in MutM. Insertions are not surprising in remote homologs. Convergence to similar architecture through independent insertions/deletions is not very common.

Despite this interesting peculiarity, there is no doubt about homology between N-domains of these proteins. COMPASS being queried with just the N-terminal domain sequence, without a more similar H2TH middle domain, finds the first MutM protein as 16th hit. Here is an alignment with one of MutM proteins found by COMPASS. This alignment is correct in the middle region. 

Subject = d1ee8a2   b.113.1.1  DNA repair protein MutM (Fpg)
length=121 filtered_length=121 Neff=15.190 Smith-Waterman score = 47 Evalue = 1.15e+01

QUERY         59     QLTTKKYDNPFNPPMFARVFRKHLEGGIIESIK========QIGNDRRIEIDIKSKDEIGDTIYRTVILEIMGKHSNLILVD  132
CONSENSUS_1   59     HLTEFPRENPKTPSNFAMLLRKHLKGARLVSIE========QLGFDRILELEFGSGDELGDEILYRLILELFGRHGNIILLD  132
                     +L+ ++ ++ +   +++  + ++L+G+R++S+E         L+ + +L +++G    L+ + +++  ++L+  +G ++++D
CONSENSUS_2   16     LLVGRTITRVEVRWPKPADFAAALVGRRILSVERRGKYLLLELDGGLVLVVHLGMSGRLRLVPPKHDHVRLELDGGELRFVD  97
d1ee8a2       16     LVLGQTLRQVVHRDPARYRNTALAEGRRILEVDRRGKFLLFALEGGVELVAHLGMTGGFRLEPTPHTRAALVLEGRTLYFHD  97

The C-domain in T0510 is a treble-clef finger that lost its Zn-binding site, deteriorated beyond recognition and gained the C-terminal β/α-unit:

3doa C-domain
N-domain of 510: 3doa residues 236-279

1ee8_A C-domain
N-domain of MutM: 1ee8 chain A residues 230-266

The blue and cyan β-strands in T0510 are structurally equivalent and homologous to green and orange β-strands in MutM, respectively.

CASP category:

Whole chain: Fold recognition.

1st domain: Fold recognition. 2nd domain: Comparative modeling:hard. 3rd domain: Fold recognition.

Closest templates:

1ee8, 1r2z, 1k82, 1tdz, 1k3x.

Target sequence - PDB file inconsistencies:

T0510    3doa.pdb    T0510.pdb    PyMOL    PyMOL of domains    

T0510    1 MAYDGLFTKKMVESLQFLTTGRVHKINQPDNDTILMVVRQNRQNHQLLLSIHPNFSRLQLTTKKYDNPFNPPMFARVFRKHLEGGIIESIKQIGNDRRIEIDIKSKDEIGDTIYRTVILEIMGKHSNLILVDENRKIIEGFKHLTPNTNHYRTVMPGFNYEAPPTQHKINPYDITGAEVLKYIDFNAGNIAKQLLNQFEGFSPLITNEIVSRRQFMTSSTLPEAFDEVMAETKLPPTPIFHKNHETGKEDFYFIKLNQFNDDTVTYDSLNDLLDRFYDARGERERVKQ 288
           |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~|||||||||||||||||||||||||||||||||||||~~~~~~~~~
3doaA    1 MAYDGLFTKKMVESLQFLTTGRVHKINQPDNDTILMVVRQNRQNHQLLLSIHPNFSRLQLTTK-------PPMFARVFRKHLEGGIIESIKQIGNDRRIEIDIKSKDEIGDTIYRTVILEIMGKHSNLILVDENRKIIEGFKHLTP-----RTVMPGFNYEAPPTQHKINPYDITGAEVLKYIDFNAGNIAKQLLNQFEGFSPLITNEIVSRRQFMTSSTLPEAFDEVMAETKLPPTPIFH-NHETGKEDFYFIKLNQFNDDTVTYDSLNDLLDRFYDA--------- 279

3-domain protein, all domains used in evaluation:

1st domain: target 1-63, 71-146, 152-165 ; pdb 1-63, 71-146, 152-165

2nd domain: target 166-235 ; pdb 166-235

3rd domain: target 236-241, 243-279 ; pdb 236-241, 243-279

Sequence classification:

Fibronectin-binding protein A N-terminus (FbpA) in Pfam.

Server predictions:

T0510:pdb 1-279:seq 1-279:FR;   alignment

distribution of first scores
First models for T0510: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

510_1:pdb 1-165:seq 1-165:FR;   alignment

distribution of first scores
First models for T0510_1: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

510_2:pdb 166-235:seq 166-235:CM_hard;   alignment

distribution of first scores
First models for T0510_2: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

510_3:pdb 236-279:seq 236-279:FR;   alignment

distribution of first scores
First models for T0510_3: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

# GROUP ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ ↓ GROUP #
T0510 510_1 510_2 510_3 T0510 510_1 510_2 510_3 T0510 510_1 510_2 510_3 T0510 510_1 510_2 510_3
First score First Z-score Best score Best Z-score
1 SAM−T08−server 35.34 28.51 36.99 40.20 36.38 39.32 65.36 53.93 56.88 38.37 37.02 41.56 2.14 2.16 1.60 1.71 1.83 1.67 1.36 0.87 1.04 0.99 1.43 0.66 35.62 28.51 36.99 41.18 37.91 40.39 67.50 53.93 59.77 38.37 37.02 41.56 1.86 1.80 1.44 1.74 1.89 1.54 1.28 0.43 0.96 0.52 0.90 0.18 SAM−T08−server 1
2 HHpred2 31.86 23.65 35.77 35.46 31.48 36.14 65.71 53.57 63.35 27.33 25.97 32.28 1.62 1.21 1.44 1.18 1.23 1.28 1.40 0.83 1.92 -0.74 -0.32 -0.35 31.86 23.65 35.77 35.46 31.48 36.14 65.71 53.57 63.35 27.33 25.97 32.28 1.26 0.80 1.27 0.99 0.99 0.96 1.05 0.38 1.49 -1.45 -0.93 -1.00 HHpred2 2
3 HHpred5 31.20 23.97 36.30 31.37 25.16 35.61 67.86 55.71 65.44 29.07 27.13 34.95 1.52 1.28 1.51 0.74 0.46 1.22 1.63 1.09 2.20 -0.47 -0.14 -0.06 31.20 23.97 36.30 31.37 25.16 35.61 67.86 55.71 65.44 29.07 27.13 34.95 1.15 0.87 1.34 0.46 0.12 0.88 1.33 0.71 1.80 -1.14 -0.74 -0.66 HHpred5 3
4 HHpred4 31.02 25.47 31.01 26.80 21.46 26.66 70.71 58.33 66.38 28.49 24.61 33.68 1.49 1.57 0.84 0.23 0.01 0.11 1.93 1.40 2.33 -0.56 -0.54 -0.20 31.02 25.47 31.01 26.80 21.46 26.66 70.71 58.33 66.38 28.49 24.61 33.68 1.12 1.18 0.58 -0.13 -0.40 -0.35 1.71 1.11 1.93 -1.24 -1.15 -0.82 HHpred4 4
5 COMA−M 30.64 25.85 32.93 36.11 34.15 34.93 59.29 52.62 53.35 30.81 25.39 35.04 1.44 1.64 1.08 1.26 1.56 1.13 0.71 0.72 0.56 -0.19 -0.41 -0.05 30.64 25.85 32.93 36.11 34.15 34.93 59.64 55.59 55.82 31.98 28.30 37.28 1.06 1.25 0.85 1.08 1.37 0.79 0.24 0.69 0.39 -0.62 -0.54 -0.37 COMA−M 5
6 pro−sp3−TASSER 30.36 25.38 40.07 37.91 34.53 40.61 60.36 57.50 58.70 39.53 34.50 50.46 1.39 1.55 1.99 1.45 1.60 1.83 0.82 1.30 1.29 1.17 1.03 1.63 30.36 25.38 40.07 37.91 34.53 42.58 60.36 57.50 58.70 45.35 41.09 59.15 1.02 1.16 1.89 1.31 1.42 1.84 0.34 0.98 0.81 1.77 1.57 2.41 pro−sp3−TASSER 6
7 Zhang−Server 30.17 22.15 38.80 34.64 30.83 39.51 63.57 60.00 63.13 33.72 24.03 41.14 1.37 0.92 1.83 1.09 1.15 1.70 1.17 1.60 1.89 0.26 -0.63 0.62 34.68 27.00 45.39 42.48 36.66 46.99 67.14 60.00 67.90 35.47 31.20 44.33 1.71 1.49 2.66 1.90 1.71 2.45 1.23 1.37 2.16 0.01 -0.06 0.53 Zhang−Server 7
8 CpHModels 30.07 22.84 29.44 35.29 29.19 33.56 64.64 52.98 58.85 19.77 16.67 13.66 1.35 1.06 0.64 1.17 0.95 0.96 1.28 0.76 1.31 -1.93 -1.80 -2.37 30.07 22.84 29.44 35.29 29.19 33.56 64.64 52.98 58.85 19.77 16.67 13.66 0.97 0.64 0.35 0.97 0.68 0.60 0.90 0.29 0.83 -2.80 -2.47 -3.36 CpHModels 8
9 RAPTOR 29.61 23.97 35.21 39.87 36.49 37.32 53.93 47.02 47.36 45.93 38.57 56.60 1.28 1.28 1.37 1.67 1.84 1.43 0.13 0.04 -0.25 2.18 1.68 2.30 29.89 24.69 35.64 39.87 36.49 37.32 53.93 47.02 48.14 45.93 44.38 59.86 0.94 1.02 1.25 1.57 1.69 1.12 -0.51 -0.63 -0.74 1.87 2.12 2.50 RAPTOR 9
10 COMA 28.48 23.93 31.70 33.17 30.12 31.67 61.79 50.36 58.22 30.81 28.30 35.42 1.11 1.27 0.93 0.93 1.07 0.73 0.97 0.44 1.22 -0.19 0.05 -0.01 29.61 26.10 32.93 34.97 30.12 34.95 61.79 56.07 58.22 30.81 28.30 37.28 0.90 1.30 0.85 0.93 0.81 0.79 0.53 0.76 0.74 -0.83 -0.54 -0.37 COMA 10
11 fais−server 28.38 23.87 34.66 40.69 34.59 34.36 59.29 48.09 59.12 41.86 40.12 47.78 1.10 1.26 1.30 1.76 1.61 1.06 0.71 0.17 1.34 1.54 1.93 1.34 30.83 25.50 35.51 40.69 34.59 36.37 67.14 54.76 59.12 41.86 40.12 50.18 1.09 1.18 1.23 1.67 1.43 0.99 1.23 0.56 0.87 1.15 1.41 1.27 fais−server 11
12 BAKER−ROBETTA 28.10 22.65 26.34 33.01 29.96 28.18 53.57 47.38 46.29 29.07 26.36 29.55 1.05 1.02 0.24 0.92 1.05 0.30 0.09 0.09 -0.39 -0.47 -0.26 -0.65 28.10 22.65 27.76 33.01 29.96 29.94 69.29 59.52 62.80 39.53 33.33 46.11 0.66 0.60 0.10 0.68 0.78 0.10 1.52 1.30 1.41 0.73 0.29 0.75 BAKER−ROBETTA 12
13 Phyre_de_novo 28.01 20.55 31.71 37.09 30.34 34.78 60.36 53.45 50.44 36.63 33.14 42.66 1.04 0.61 0.93 1.36 1.09 1.11 0.82 0.82 0.17 0.72 0.82 0.78 29.04 21.08 33.39 38.40 31.75 36.49 63.57 54.52 55.05 44.19 41.47 46.26 0.81 0.28 0.92 1.38 1.03 1.01 0.76 0.52 0.27 1.56 1.64 0.77 Phyre_de_novo 13
14 GS−KudlatyPred 27.91 22.71 26.67 33.01 28.87 28.77 53.93 47.26 48.17 30.81 28.88 30.45 1.03 1.03 0.29 0.92 0.91 0.37 0.13 0.07 -0.14 -0.19 0.14 -0.55 27.91 22.71 26.83 33.50 31.86 29.02 55.71 48.81 48.76 31.98 29.26 30.80 0.63 0.61 -0.03 0.74 1.05 -0.02 -0.28 -0.36 -0.65 -0.62 -0.38 -1.19 GS−KudlatyPred 14
15 3D−JIGSAW_V3 27.73 22.52 21.56 33.82 28.92 25.61 57.14 52.62 51.04 18.61 15.50 14.68 1.00 1.00 -0.36 1.00 0.92 -0.02 0.48 0.72 0.25 -2.11 -1.98 -2.26 27.73 22.52 21.58 33.82 30.28 25.98 57.14 52.62 51.10 18.61 17.83 15.11 0.60 0.57 -0.79 0.78 0.83 -0.44 -0.09 0.23 -0.31 -3.00 -2.27 -3.18 3D−JIGSAW_V3 15
16 nFOLD3 27.54 20.90 19.90 34.80 32.84 24.68 57.50 52.50 53.60 0.00 0.00 5.09 0.97 0.68 -0.57 1.11 1.40 -0.13 0.51 0.70 0.60 -5.03 -4.44 -3.31 28.38 23.25 19.94 35.95 34.75 24.68 58.93 55.95 53.60 40.12 34.30 44.47 0.70 0.72 -1.03 1.06 1.45 -0.62 0.15 0.74 0.06 0.84 0.45 0.54 nFOLD3 16
17 FEIG 27.44 23.75 38.31 34.31 31.81 45.81 54.29 50.24 48.95 27.91 25.39 35.24 0.95 1.23 1.77 1.06 1.27 2.47 0.17 0.43 -0.03 -0.65 -0.41 -0.03 27.82 25.31 39.21 35.29 33.33 46.58 63.57 54.76 53.81 31.39 29.07 37.76 0.61 1.14 1.76 0.97 1.25 2.39 0.76 0.56 0.09 -0.72 -0.41 -0.31 FEIG 17
18 METATASSER 27.44 22.24 31.48 34.64 26.69 32.81 50.36 45.36 49.56 34.88 31.39 40.50 0.95 0.94 0.90 1.09 0.65 0.87 -0.25 -0.16 0.05 0.44 0.54 0.55 29.70 25.25 42.38 35.13 31.75 44.76 58.21 55.83 60.44 39.53 35.27 49.79 0.91 1.13 2.22 0.95 1.03 2.14 0.05 0.73 1.06 0.73 0.61 1.22 METATASSER 18
19 MUSTER 27.16 20.46 31.27 35.13 29.57 33.57 59.29 55.83 53.25 31.98 26.94 33.43 0.91 0.60 0.87 1.15 1.00 0.96 0.71 1.10 0.55 -0.01 -0.17 -0.22 34.96 26.79 33.57 35.62 30.23 33.57 65.71 55.83 61.35 31.98 26.94 33.43 1.75 1.45 0.95 1.01 0.82 0.60 1.05 0.73 1.20 -0.62 -0.77 -0.86 MUSTER 19
20 mGenTHREADER 26.22 22.27 15.45 32.84 29.47 21.03 49.64 44.64 29.43 30.23 24.81 23.04 0.77 0.95 -1.14 0.90 0.99 -0.58 -0.33 -0.24 -2.67 -0.29 -0.50 -1.35 26.22 22.27 15.45 32.84 29.47 21.03 49.64 44.64 29.43 30.23 24.81 23.04 0.36 0.52 -1.68 0.65 0.72 -1.12 -1.08 -1.00 -3.48 -0.93 -1.12 -2.17 mGenTHREADER 20
21 3DShot2 25.56 20.93 23.23 24.18 18.95 22.36 55.00 46.91 45.87 27.33 20.74 36.70 0.67 0.69 -0.15 -0.05 -0.29 -0.42 0.25 0.03 -0.45 -0.74 -1.15 0.13 25.56 20.93 23.23 24.18 18.95 22.36 55.00 46.91 45.87 27.33 20.74 36.70 0.25 0.25 -0.55 -0.47 -0.74 -0.94 -0.37 -0.65 -1.07 -1.45 -1.79 -0.44 3DShot2 21
22 FFASstandard 24.81 19.93 23.07 29.74 25.27 27.11 52.50 45.59 46.74 32.56 27.13 25.00 0.56 0.49 -0.17 0.56 0.48 0.17 -0.02 -0.13 -0.33 0.08 -0.14 -1.14 24.81 19.93 24.90 29.74 25.27 29.71 55.71 50.48 49.27 32.56 28.88 34.72 0.13 0.04 -0.31 0.25 0.13 0.07 -0.28 -0.10 -0.57 -0.51 -0.45 -0.69 FFASstandard 22
23 MULTICOM−CLUSTER 23.78 20.61 26.65 25.82 23.86 25.26 58.57 54.17 52.22 30.81 23.26 37.85 0.40 0.62 0.28 0.13 0.31 -0.06 0.63 0.90 0.41 -0.19 -0.75 0.26 23.78 20.61 30.45 32.84 29.68 33.78 60.00 54.52 52.56 32.56 28.88 39.02 -0.03 0.18 0.49 0.65 0.74 0.63 0.29 0.52 -0.09 -0.51 -0.45 -0.15 MULTICOM−CLUSTER 23
24 MULTICOM−REFINE 23.59 20.33 26.69 25.65 23.91 25.33 58.21 53.81 52.20 30.81 23.64 37.76 0.37 0.57 0.29 0.11 0.31 -0.05 0.59 0.86 0.41 -0.19 -0.69 0.25 32.71 26.19 31.65 32.68 29.74 33.63 61.79 53.81 57.00 31.98 26.55 38.98 1.39 1.32 0.67 0.63 0.75 0.61 0.53 0.41 0.56 -0.62 -0.83 -0.15 MULTICOM−REFINE 24
25 Pcons_dot_net 23.40 19.83 24.32 28.59 24.56 24.25 52.50 48.45 48.15 22.67 21.90 29.03 0.35 0.47 -0.01 0.43 0.39 -0.18 -0.02 0.21 -0.14 -1.47 -0.97 -0.70 24.25 20.61 24.32 31.37 27.78 26.72 57.14 51.67 53.55 24.42 22.48 30.57 0.04 0.18 -0.39 0.46 0.48 -0.34 -0.09 0.08 0.05 -1.97 -1.51 -1.22 Pcons_dot_net 25
26 Pcons_multi 23.40 19.83 24.32 28.59 24.56 24.25 52.50 48.45 48.15 22.67 21.90 29.03 0.35 0.47 -0.01 0.43 0.39 -0.18 -0.02 0.21 -0.14 -1.47 -0.97 -0.70 25.38 21.37 25.29 29.25 25.55 25.46 58.93 54.05 52.28 31.39 23.26 32.23 0.22 0.34 -0.25 0.19 0.17 -0.51 0.15 0.45 -0.13 -0.72 -1.38 -1.01 Pcons_multi 26
27 FFASflextemplate 23.12 19.17 21.53 25.98 21.84 26.02 51.07 45.36 43.16 29.65 25.58 25.42 0.30 0.35 -0.37 0.14 0.06 0.04 -0.18 -0.16 -0.81 -0.38 -0.38 -1.09 23.78 19.83 21.53 26.47 22.33 26.02 52.14 49.05 44.34 30.81 26.36 25.86 -0.03 0.02 -0.80 -0.17 -0.28 -0.44 -0.75 -0.32 -1.30 -0.83 -0.86 -1.82 FFASflextemplate 27
28 3D−JIGSAW_AEP 20.68 18.11 22.74 35.78 31.32 29.34 55.71 50.71 47.21 18.61 17.83 15.21 -0.06 0.14 -0.21 1.22 1.21 0.44 0.32 0.49 -0.27 -2.11 -1.61 -2.21 21.99 19.36 23.57 36.11 31.75 29.66 57.86 54.76 50.15 18.61 17.83 15.27 -0.32 -0.08 -0.50 1.08 1.03 0.06 0.01 0.56 -0.45 -3.00 -2.27 -3.16 3D−JIGSAW_AEP 28
29 Phyre2 20.39 16.32 23.32 13.72 11.93 20.66 61.07 49.88 56.62 38.37 34.50 37.61 -0.11 -0.21 -0.14 -1.20 -1.14 -0.62 0.90 0.39 1.01 0.99 1.03 0.23 21.71 17.26 24.69 16.01 15.20 21.59 65.00 55.24 60.26 39.53 37.60 39.43 -0.37 -0.51 -0.34 -1.53 -1.26 -1.05 0.95 0.64 1.04 0.73 1.00 -0.09 Phyre2 29
30 Phragment 19.55 16.35 25.30 13.72 11.98 22.27 60.36 51.79 56.96 39.53 36.05 42.86 -0.23 -0.20 0.11 -1.20 -1.14 -0.43 0.82 0.62 1.05 1.17 1.28 0.80 20.02 16.95 25.91 13.72 11.98 23.39 64.29 55.24 59.81 39.53 37.21 47.61 -0.64 -0.57 -0.16 -1.83 -1.71 -0.80 0.86 0.64 0.97 0.73 0.93 0.94 Phragment 30
31 Poing 19.55 15.73 28.93 13.56 10.62 26.93 62.14 50.95 56.59 42.44 38.95 47.99 -0.23 -0.32 0.57 -1.22 -1.30 0.15 1.01 0.51 1.00 1.63 1.74 1.36 20.02 17.14 28.93 21.08 19.01 30.62 62.14 51.19 56.59 42.44 38.95 47.99 -0.64 -0.53 0.27 -0.87 -0.74 0.20 0.57 0.01 0.50 1.25 1.22 0.99 Poing 31
32 circle 19.45 16.51 15.19 20.75 17.81 11.35 50.71 47.38 42.44 33.72 27.91 41.49 -0.25 -0.17 -1.17 -0.43 -0.43 -1.77 -0.22 0.09 -0.91 0.26 -0.01 0.65 25.94 19.42 22.35 32.35 25.71 29.97 59.64 56.67 52.55 39.53 36.05 44.88 0.31 -0.06 -0.68 0.59 0.19 0.11 0.24 0.86 -0.09 0.73 0.74 0.60 circle 32
33 MULTICOM−RANK 18.89 16.32 20.53 15.69 12.31 17.15 57.86 53.21 52.09 30.81 25.00 38.94 -0.33 -0.21 -0.49 -0.99 -1.10 -1.06 0.55 0.79 0.39 -0.19 -0.47 0.38 23.59 20.33 26.69 25.65 23.91 25.33 60.00 54.52 52.56 32.56 26.94 38.94 -0.07 0.12 -0.05 -0.28 -0.06 -0.53 0.29 0.52 -0.09 -0.51 -0.77 -0.16 MULTICOM−RANK 33
34 MULTICOM−CMFR 18.80 16.92 30.43 32.68 29.63 33.86 55.71 50.48 51.50 30.81 25.00 39.08 -0.35 -0.09 0.76 0.88 1.01 1.00 0.32 0.46 0.31 -0.19 -0.47 0.39 32.33 27.38 31.76 32.68 29.68 33.86 62.14 53.33 57.35 30.81 26.16 39.08 1.33 1.57 0.68 0.63 0.74 0.64 0.57 0.34 0.61 -0.83 -0.90 -0.14 MULTICOM−CMFR 34
35 MUProt 18.70 16.82 30.45 32.84 29.68 33.78 56.07 50.12 51.81 30.81 27.13 39.02 -0.36 -0.11 0.77 0.90 1.01 0.99 0.36 0.42 0.36 -0.19 -0.14 0.39 32.14 25.94 34.50 33.99 29.68 34.67 67.50 54.52 65.44 31.98 27.13 39.02 1.30 1.27 1.08 0.80 0.74 0.75 1.28 0.52 1.80 -0.62 -0.74 -0.15 MUProt 35
36 panther_server 18.61 16.16 12.92 14.71 12.74 10.28 55.00 51.67 46.81 27.33 24.61 26.19 -0.38 -0.24 -1.46 -1.10 -1.04 -1.90 0.25 0.60 -0.32 -0.74 -0.54 -1.01 19.08 16.26 15.52 16.67 15.63 11.28 55.71 51.67 49.13 36.05 29.46 34.65 -0.79 -0.71 -1.67 -1.44 -1.21 -2.47 -0.28 0.08 -0.60 0.11 -0.35 -0.70 panther_server 36
37 GeneSilicoMetaServer 18.05 16.35 10.37 13.40 11.22 6.19 57.14 53.93 50.79 22.09 19.77 22.89 -0.46 -0.20 -1.79 -1.24 -1.23 -2.41 0.48 0.87 0.22 -1.56 -1.30 -1.37 25.56 19.67 23.17 29.57 25.65 27.12 59.64 55.59 50.79 29.07 26.16 30.80 0.25 -0.01 -0.56 0.23 0.19 -0.28 0.24 0.69 -0.35 -1.14 -0.90 -1.19 GeneSilicoMetaServer 37
38 FFASsuboptimal 18.05 15.41 12.16 16.50 14.38 9.63 52.50 48.69 47.23 27.91 25.00 23.64 -0.46 -0.38 -1.56 -0.90 -0.85 -1.98 -0.02 0.24 -0.26 -0.65 -0.47 -1.29 18.80 16.35 19.34 19.61 17.59 14.95 57.14 52.38 52.52 35.47 31.98 39.60 -0.83 -0.69 -1.12 -1.06 -0.93 -1.96 -0.09 0.19 -0.10 0.01 0.07 -0.07 FFASsuboptimal 38
39 MUFOLD−MD 17.76 13.94 41.40 31.21 23.91 44.68 46.79 37.98 53.62 45.93 44.38 61.36 -0.50 -0.67 2.16 0.72 0.31 2.33 -0.64 -1.04 0.60 2.18 2.60 2.82 17.76 13.94 41.40 31.21 23.91 44.68 61.43 51.43 56.61 55.81 49.23 61.36 -1.00 -1.19 2.08 0.44 -0.06 2.13 0.48 0.05 0.50 3.64 2.92 2.69 MUFOLD−MD 39
40 PSI 17.57 14.91 25.61 20.10 17.05 23.68 53.21 47.50 47.71 40.12 36.24 52.49 -0.53 -0.48 0.15 -0.50 -0.52 -0.25 0.05 0.10 -0.20 1.27 1.31 1.85 17.57 14.91 27.95 20.10 17.05 26.63 53.57 47.86 49.32 50.58 47.87 60.00 -1.03 -0.99 0.13 -1.00 -1.01 -0.35 -0.56 -0.50 -0.57 2.70 2.70 2.52 PSI 40
41 PS2−server 17.57 14.25 17.61 16.34 15.63 16.51 51.79 47.14 46.94 26.16 24.23 30.77 -0.53 -0.61 -0.87 -0.92 -0.69 -1.14 -0.10 0.06 -0.30 -0.92 -0.60 -0.51 26.13 20.96 26.71 19.44 17.05 28.21 64.29 56.07 59.96 34.30 28.10 38.60 0.34 0.25 -0.05 -1.08 -1.01 -0.13 0.86 0.76 0.99 -0.20 -0.58 -0.20 PS2−server 41
42 rehtnap 16.45 13.94 3.41 14.54 12.36 4.34 39.64 38.33 23.00 26.16 22.29 22.03 -0.70 -0.67 -2.67 -1.11 -1.09 -2.63 -1.41 -1.00 -3.54 -0.92 -0.90 -1.46 16.92 14.72 6.29 14.71 12.96 4.79 42.86 39.29 35.58 26.16 22.87 22.03 -1.13 -1.03 -3.01 -1.70 -1.58 -3.36 -1.97 -1.83 -2.58 -1.66 -1.44 -2.30 rehtnap 42
43 Pcons_local 15.51 14.25 0.77 10.62 9.31 -4.07 55.71 50.95 50.34 0.00 0.00 5.09 -0.84 -0.61 -3.01 -1.55 -1.46 -3.67 0.32 0.51 0.16 -5.03 -4.44 -3.31 15.51 14.25 0.77 10.62 9.31 -4.07 55.71 50.95 50.34 0.00 0.00 5.09 -1.36 -1.12 -3.81 -2.23 -2.08 -4.58 -0.28 -0.03 -0.42 -6.32 -5.23 -4.45 Pcons_local 43
44 SAM−T02−server 15.32 11.31 -0.76 7.84 7.19 -7.40 53.57 50.48 50.82 6.98 6.98 5.67 -0.87 -1.18 -3.20 -1.85 -1.72 -4.08 0.09 0.46 0.22 -3.93 -3.33 -3.24 15.70 14.07 7.53 24.18 23.53 7.72 55.71 52.50 53.22 20.35 18.80 15.49 -1.33 -1.16 -2.83 -0.47 -0.11 -2.96 -0.28 0.21 0.00 -2.69 -2.11 -3.13 SAM−T02−server 44
45 3Dpro 15.13 13.75 21.12 13.56 11.87 19.08 55.00 49.76 51.69 30.23 29.07 37.69 -0.90 -0.71 -0.42 -1.22 -1.15 -0.82 0.25 0.37 0.34 -0.29 0.17 0.24 19.08 14.76 23.71 16.18 15.30 21.08 55.00 49.76 52.73 34.88 34.88 46.87 -0.79 -1.02 -0.48 -1.51 -1.25 -1.12 -0.37 -0.21 -0.07 -0.10 0.55 0.85 3Dpro 45
46 GS−MetaServer2 15.04 11.22 -2.99 2.61 2.61 -12.98 53.57 44.29 50.56 18.02 13.76 14.10 -0.91 -1.20 -3.49 -2.43 -2.27 -4.77 0.09 -0.29 0.19 -2.20 -2.26 -2.33 25.56 19.36 23.17 27.94 23.80 27.12 59.64 55.59 50.79 28.49 26.16 30.80 0.25 -0.08 -0.56 0.02 -0.07 -0.28 0.24 0.69 -0.35 -1.24 -0.90 -1.19 GS−MetaServer2 46
47 FOLDpro 14.85 13.00 23.71 13.89 12.36 21.08 53.93 46.79 52.73 32.56 25.97 44.61 -0.94 -0.85 -0.09 -1.19 -1.09 -0.57 0.13 0.02 0.48 0.08 -0.32 0.99 19.64 16.23 23.71 16.18 15.30 21.08 55.71 49.76 52.73 33.72 29.07 44.61 -0.70 -0.72 -0.48 -1.51 -1.25 -1.12 -0.28 -0.21 -0.07 -0.31 -0.41 0.56 FOLDpro 47
48 FALCON_CONSENSUS 13.44 11.75 24.05 15.69 14.81 24.14 48.57 43.09 45.42 41.28 39.73 44.99 -1.15 -1.09 -0.05 -0.99 -0.79 -0.20 -0.45 -0.43 -0.51 1.45 1.87 1.03 14.29 12.91 26.77 16.67 14.81 28.71 50.36 46.67 47.32 43.02 39.73 51.44 -1.55 -1.40 -0.04 -1.44 -1.32 -0.07 -0.98 -0.69 -0.86 1.35 1.35 1.43 FALCON_CONSENSUS 48
49 mariner1 13.16 11.72 14.63 14.71 11.87 18.49 50.36 44.88 50.58 0.00 0.00 5.09 -1.20 -1.10 -1.25 -1.10 -1.15 -0.89 -0.25 -0.21 0.19 -5.03 -4.44 -3.31 17.39 14.54 21.01 20.75 14.43 23.97 66.43 55.83 62.93 34.88 31.59 44.83 -1.06 -1.06 -0.87 -0.91 -1.37 -0.72 1.14 0.73 1.43 -0.10 0.00 0.59 mariner1 49
50 FALCON 12.97 12.47 26.77 15.69 13.29 28.71 48.57 46.67 44.02 43.02 37.98 45.64 -1.23 -0.95 0.30 -0.99 -0.98 0.37 -0.45 0.00 -0.70 1.72 1.59 1.11 14.29 12.91 26.77 16.67 14.81 28.71 50.36 46.67 47.32 43.02 39.73 51.44 -1.55 -1.40 -0.04 -1.44 -1.32 -0.07 -0.98 -0.69 -0.86 1.35 1.35 1.43 FALCON 50
51 BioSerf 12.41 9.27 18.47 15.36 9.86 18.96 43.93 32.98 42.74 33.14 23.64 32.32 -1.31 -1.57 -0.76 -1.02 -1.39 -0.83 -0.94 -1.64 -0.87 0.17 -0.69 -0.34 12.41 9.27 18.47 15.36 9.86 18.96 43.93 32.98 42.74 33.14 23.64 32.32 -1.85 -2.14 -1.24 -1.61 -2.01 -1.41 -1.83 -2.80 -1.53 -0.41 -1.31 -1.00 BioSerf 51
52 LOOPP_Server 12.22 9.52 6.55 21.41 17.27 18.25 21.07 19.88 15.46 0.00 0.00 5.09 -1.34 -1.53 -2.27 -0.36 -0.49 -0.92 -3.40 -3.22 -4.56 -5.03 -4.44 -3.31 12.22 9.52 17.69 21.41 17.27 21.20 29.64 26.31 32.86 32.56 31.01 40.22 -1.88 -2.09 -1.36 -0.83 -0.98 -1.10 -3.72 -3.83 -2.98 -0.51 -0.09 0.01 LOOPP_Server 52
53 FUGUE_KM 11.94 10.81 14.15 14.05 12.31 12.74 41.79 37.26 40.15 31.98 27.91 35.22 -1.38 -1.28 -1.31 -1.17 -1.10 -1.60 -1.17 -1.13 -1.22 -0.01 -0.01 -0.03 24.72 21.59 18.63 28.11 25.27 18.71 56.07 52.02 51.61 31.98 27.91 35.22 0.12 0.38 -1.22 0.04 0.13 -1.44 -0.23 0.14 -0.23 -0.62 -0.61 -0.63 FUGUE_KM 53
54 RBO−Proteus 11.65 9.71 32.94 20.26 17.43 36.21 37.50 28.57 47.37 41.86 39.15 49.83 -1.42 -1.49 1.08 -0.49 -0.47 1.29 -1.64 -2.17 -0.25 1.54 1.77 1.56 14.47 12.41 35.24 25.33 21.73 40.51 37.50 34.29 47.37 43.02 40.31 49.83 -1.52 -1.50 1.19 -0.32 -0.36 1.56 -2.68 -2.60 -0.85 1.35 1.45 1.22 RBO−Proteus 54
55 Pushchino 10.81 8.11 11.50 18.63 14.05 25.18 31.07 27.74 13.77 19.77 15.50 9.95 -1.55 -1.80 -1.64 -0.66 -0.89 -0.07 -2.33 -2.27 -4.79 -1.93 -1.98 -2.78 10.81 8.11 11.50 18.63 14.05 25.18 31.07 27.74 13.77 19.77 15.50 9.95 -2.11 -2.38 -2.25 -1.19 -1.42 -0.55 -3.53 -3.61 -5.78 -2.80 -2.66 -3.84 Pushchino 55
56 FAMSD 10.81 7.61 16.64 13.56 12.74 17.78 28.93 23.93 37.99 29.07 25.97 33.45 -1.55 -1.90 -0.99 -1.22 -1.04 -0.98 -2.56 -2.73 -1.51 -0.47 -0.32 -0.22 21.05 17.42 21.21 18.95 16.18 22.81 60.00 52.38 54.69 37.21 34.30 39.15 -0.47 -0.47 -0.85 -1.15 -1.13 -0.88 0.29 0.19 0.22 0.32 0.45 -0.13 FAMSD 56
57 forecast 10.34 9.09 19.31 15.85 13.34 22.45 29.29 27.62 34.10 31.39 30.43 38.18 -1.62 -1.61 -0.65 -0.97 -0.97 -0.40 -2.52 -2.29 -2.04 -0.10 0.39 0.29 10.53 9.68 19.31 16.99 14.81 22.45 30.00 28.09 34.10 40.12 35.85 38.18 -2.15 -2.06 -1.12 -1.40 -1.32 -0.93 -3.67 -3.56 -2.80 0.84 0.71 -0.25 forecast 57
58 MUFOLD−Server 10.24 7.86 19.54 15.03 8.99 20.45 31.79 24.76 38.60 36.05 18.41 35.22 -1.64 -1.85 -0.62 -1.06 -1.50 -0.65 -2.25 -2.63 -1.43 0.63 -1.52 -0.03 10.43 8.40 23.60 16.18 12.42 26.07 32.14 25.00 40.26 38.37 25.19 35.91 -2.17 -2.32 -0.50 -1.51 -1.65 -0.43 -3.39 -4.03 -1.90 0.52 -1.06 -0.54 MUFOLD−Server 58
59 Distill 9.96 8.99 19.90 17.16 15.30 22.70 26.07 23.93 35.50 38.95 34.30 39.13 -1.68 -1.63 -0.57 -0.83 -0.73 -0.37 -2.86 -2.73 -1.85 1.08 1.00 0.40 11.00 8.99 23.32 18.95 15.30 28.12 28.93 25.00 36.35 38.95 34.69 41.27 -2.08 -2.20 -0.54 -1.15 -1.25 -0.15 -3.81 -4.03 -2.47 0.63 0.52 0.14 Distill 59
60 RANDOM 9.02 7.79 9.02 12.92 10.78 12.92 29.31 23.55 29.31 30.40 27.26 30.40 -1.82 -1.86 -1.96 -1.29 -1.28 -1.58 -2.52 -2.78 -2.69 -0.26 -0.11 -0.55 9.02 7.79 9.02 12.92 10.78 12.92 29.31 23.55 29.31 30.40 27.26 30.40 -2.39 -2.45 -2.61 -1.93 -1.88 -2.24 -3.76 -4.26 -3.50 -0.90 -0.71 -1.24 RANDOM 60
61 LEE−SERVER 9.02 7.33 14.50 11.77 10.73 15.43 26.07 25.59 30.95 43.02 36.43 39.46 -1.82 -1.95 -1.26 -1.42 -1.29 -1.27 -2.86 -2.53 -2.47 1.72 1.34 0.43 13.16 11.03 26.15 21.89 16.78 33.75 33.93 27.26 40.54 43.02 36.43 39.46 -1.73 -1.78 -0.13 -0.77 -1.05 0.63 -3.15 -3.68 -1.85 1.35 0.80 -0.09 LEE−SERVER 61
62 huber−torda−server 8.84 8.14 10.37 13.89 12.47 15.61 23.57 21.43 20.16 31.39 26.74 30.44 -1.85 -1.79 -1.79 -1.19 -1.08 -1.25 -3.13 -3.03 -3.93 -0.10 -0.20 -0.55 10.34 8.14 12.62 13.89 12.47 15.61 39.29 31.91 38.93 36.63 35.08 35.16 -2.18 -2.38 -2.09 -1.80 -1.64 -1.87 -2.44 -2.97 -2.09 0.21 0.58 -0.64 huber−torda−server 62
63 OLGAFS 8.74 7.74 2.14 12.09 10.95 3.19 25.71 21.43 21.11 24.42 20.93 25.13 -1.86 -1.87 -2.83 -1.38 -1.26 -2.78 -2.90 -3.03 -3.80 -1.20 -1.12 -1.13 14.10 11.47 12.07 12.09 10.95 10.23 51.07 47.02 43.17 27.33 23.84 28.40 -1.58 -1.69 -2.17 -2.04 -1.85 -2.61 -0.89 -0.63 -1.47 -1.45 -1.28 -1.49 OLGAFS 63
64 schenk−torda−server 8.55 8.27 13.14 11.60 11.60 15.15 27.50 26.55 32.87 33.72 30.62 30.78 -1.89 -1.77 -1.43 -1.44 -1.18 -1.30 -2.71 -2.42 -2.21 0.26 0.42 -0.51 8.55 8.27 13.14 11.60 11.60 15.15 27.50 26.55 32.87 34.88 30.62 37.34 -2.47 -2.35 -2.02 -2.10 -1.76 -1.93 -4.00 -3.79 -2.98 -0.10 -0.16 -0.36 schenk−torda−server 64
65 SAM−T06−server 8.18 7.24 14.68 14.38 12.64 14.98 25.36 22.98 27.77 39.53 38.37 46.70 -1.95 -1.97 -1.24 -1.13 -1.06 -1.32 -2.94 -2.85 -2.90 1.17 1.65 1.22 24.44 20.24 16.31 30.07 28.76 20.54 52.14 49.52 50.10 39.53 38.37 46.70 0.07 0.10 -1.56 0.29 0.62 -1.19 -0.75 -0.25 -0.45 0.73 1.12 0.83 SAM−T06−server 65
66 pipe_int 7.89 6.36 15.80 11.93 10.68 15.26 21.07 17.14 36.44 26.74 25.97 40.02 -1.99 -2.14 -1.10 -1.40 -1.29 -1.29 -3.40 -3.55 -1.72 -0.83 -0.32 0.49 7.89 6.36 15.80 11.93 10.68 15.26 21.07 17.14 36.44 26.74 25.97 40.02 -2.57 -2.74 -1.63 -2.06 -1.89 -1.92 -4.85 -5.25 -2.45 -1.55 -0.93 -0.02 pipe_int 66
67 ACOMPMOD                                                                         -1.82 -1.86 -1.96 -1.29 -1.28 -1.58 -2.52 -2.78 -2.69 -0.26 -0.11 -0.55                                                                         -2.39 -2.45 -2.61 -1.93 -1.88 -2.24 -3.76 -4.26 -3.50 -0.90 -0.71 -1.24 ACOMPMOD 67
68 BHAGEERATH                                                                         -1.82 -1.86 -1.96 -1.29 -1.28 -1.58 -2.52 -2.78 -2.69 -0.26 -0.11 -0.55                                                                         -2.39 -2.45 -2.61 -1.93 -1.88 -2.24 -3.76 -4.26 -3.50 -0.90 -0.71 -1.24 BHAGEERATH 68
69 Fiser−M4T                                                                         -1.82 -1.86 -1.96 -1.29 -1.28 -1.58 -2.52 -2.78 -2.69 -0.26 -0.11 -0.55                                                                         -2.39 -2.45 -2.61 -1.93 -1.88 -2.24 -3.76 -4.26 -3.50 -0.90 -0.71 -1.24 Fiser−M4T 69
70 Frankenstein                                                                         -1.82 -1.86 -1.96 -1.29 -1.28 -1.58 -2.52 -2.78 -2.69 -0.26 -0.11 -0.55                                                                         -2.39 -2.45 -2.61 -1.93 -1.88 -2.24 -3.76 -4.26 -3.50 -0.90 -0.71 -1.24 Frankenstein 70
71 YASARA                                                                         -1.82 -1.86 -1.96 -1.29 -1.28 -1.58 -2.52 -2.78 -2.69 -0.26 -0.11 -0.55                                                                         -2.39 -2.45 -2.61 -1.93 -1.88 -2.24 -3.76 -4.26 -3.50 -0.90 -0.71 -1.24 YASARA 71
72 keasar−server                                                                         -1.82 -1.86 -1.96 -1.29 -1.28 -1.58 -2.52 -2.78 -2.69 -0.26 -0.11 -0.55                                                                         -2.39 -2.45 -2.61 -1.93 -1.88 -2.24 -3.76 -4.26 -3.50 -0.90 -0.71 -1.24 keasar−server 72
73 mahmood−torda−server                                                                         -1.82 -1.86 -1.96 -1.29 -1.28 -1.58 -2.52 -2.78 -2.69 -0.26 -0.11 -0.55                                                                         -2.39 -2.45 -2.61 -1.93 -1.88 -2.24 -3.76 -4.26 -3.50 -0.90 -0.71 -1.24 mahmood−torda−server 73
74 test_http_server_01                                                                         -1.82 -1.86 -1.96 -1.29 -1.28 -1.58 -2.52 -2.78 -2.69 -0.26 -0.11 -0.55                                                                         -2.39 -2.45 -2.61 -1.93 -1.88 -2.24 -3.76 -4.26 -3.50 -0.90 -0.71 -1.24 test_http_server_01 74