T0429

Targets
387 388 389 390
391 392 393 394
395 396 397 398
399 400 401 402
403 404 405 406
407 408 409 410
411 412 413 414
415 416 417 418
419 420 421 422
423 424 425 426
427 428 429 430
431 432 433 434
435 436 437 438
439 440 441 442
443 444 445 446
447 448 449 450
451 452 453 454
455 456 457 458
459 460 461 462
463 464 465 466
467 468 469 470
471 472 473 474
475 476 477 478
479 480 481 482
483 484 485 486
487 488 489 490
491 492 493 494
495 496 497 498
499 500 501 502
503 504 505 506
507 508 509 510
511 512 513 514

T0429

tandem tudor domains of the E3 ubiquitin-protein ligase UHRF1 from Homo sapiens

Target type: Human/Server

Target sequence:

>T0429 SDC130H02, Homo sapiens, 178 residues
MHHHHHHSSGRENLYFQGMWDETELGLYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGE

Structure:
Method: X-ray, res=2.4Å, R/Rfree=0.22/0.28
Determined by: SGC
PDB ID: 3db3

3db3_A cartoon
Cartoon diagram of 429: chain A

PyMOL of 3db3

Domains:  PyMOL of domains

Two domains, duplication. Residue ranges in PDB: 127-207 and 208-283. Residue ranges in target: 20-100 and 101-176

429 domain evaluation plot
Correlation between weighted by the number of residues sum of GDT-TS scores for domain-based evlatuation (y, vertical axis) and whole chain GDT-TS (x, horizontal axis).

To compute the weighted sum, GDT-TS for each domain was multiplied by the domain length, and this sum was divided by the sum of domain lengths. Each point represents first server model. Green, gray and black points are top 10, bottom 25% and the rest of prediction models. Blue line is the best-fit slope line (intersection 0) to the top 10 server models. Red line is the diagonal. Slope and root mean square y-x distance for the top 10 models (average difference between the weighted sum of domain GDT-TS scores and the whole chain GDT-TS score) are shown above the plot.

Structure classification:

SH3 barrel fold.

CASP category:

Whole chain: Fold recognition.

1st domain: Comparative modeling:hard. 2nd domain: Fold recognition.

Closest templates:

2g3r, 2qqr, 1ssf, 2r58, 2eqm, 1wjq, 1wgs. 

1mhn_A   ------------------------LQQWKVGDKCSAIWSE-----DGCIYPATIASIDFKR------------------ETCVVVYTGYG--NREE-QNLSDLLSPICE----------------
2gf7_A   -------------------------QSITAGQKVISKHK------NGRFYQCEVVRLTTE-------------------TFYEVNFDDG---SFSDNLYPEDIVSQDCL----------------
1ssf_A   --------------------------NSFVGLRVVAKWSS-----NGYFYSGKITRDVGA-------------------GKYKLLFDDG---YECD-VLGKDILLC-------------------
2bkd_N   ----------------------------MEELVVEVRGS------NGAFYKAFVKDVXE--------------------DSITVAFENNW-QPDRQ-IPFXDVRFPPPVGY--------------
T0429_1  MHHHHHHSSGRENLYFQGMWDETELGLYKVNEYVDARDTN-----MGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGVVQ-MNSRDVRARARTII--------------
T0429_2  -----------------------KWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRT--------------ARELYANVVLGDDSLNDCRI-IFVDEVFKIERPGE--------------
2bkd_N   ----------------------NKDINESDEVEVYSRANE-----KEPCCWWLAKVRMIKG------------------EFYVIEYAACDATYNEI-VTIERLRSVNPNKPATKDTFXKIKLDVP
1ssf_A   -------------------------DPIPLDTEVTALSE------DEYFSAGVVKGHRKES----------------GELYYSIEKEG----QRKW-YKRMAVILSLEQGNRLREQYGLGPYE--
2gf7_A   -----------------------QFGPPAEGEVVQVRWT------DGQVYGAKFVASHPI-------------------QMYQVEFEDG---SQLV-VKRDDVYTLDEELP--------------

Target sequence - PDB file inconsistencies:

T0429    3db3.pdb    T0429.pdb    PyMOL    PyMOL of domains    

T0429    1 MHHHHHHSSGRENLYFQGMWDETELGLYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGE 178
           ~~~~~~~~~~~~~~~~~~~||||||||||||||||||||||||||||||||||||~~~~~~~~~~~~~~~~~||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~
3db3A  127 -------------------WDETELGLYKVNEYVDARDTNMGAWFEAQVVRVTRK-----------------EDVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERP-- 283

Residue change log: change 148, 199, 224, MSE to MET;

2-domain protein, both domains used in evaluation:

1st domain: target 20-55, 73-100 ; pdb 127-162, 180-207

2nd domain: target 101-176 ; pdb 208-283

Sequence classification:

Tudor domain (PF00567) in Pfam.

Server predictions:

T0429:pdb 127-283:seq 20-176:FR;   alignment

distribution of first scores
First models for T0429: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

429_1:pdb 127-207:seq 20-100:CM_hard;   alignment

distribution of first scores
First models for T0429_1: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

429_2:pdb 208-283:seq 101-176:FR;   alignment

distribution of first scores
First models for T0429_2: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

# GROUP ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ ↓ GROUP #
T0429 429_1 429_2 T0429 429_1 429_2 T0429 429_1 429_2 T0429 429_1 429_2
First score First Z-score Best score Best Z-score
1 TASSER 44.82 39.82 53.23 73.83 70.18 73.38 52.30 45.72 49.39 4.00 3.84 2.60 2.76 2.87 2.42 2.86 2.99 2.26 44.82 39.82 53.23 73.83 70.18 73.38 56.58 53.07 51.81 2.85 2.84 2.26 2.00 2.08 1.94 2.86 3.53 2.12 TASSER 1
2 DBAKER 40.00 38.57 55.19 78.91 72.92 77.51 51.32 48.47 49.24 3.26 3.63 2.79 3.12 3.07 2.71 2.74 3.37 2.24 43.75 39.58 55.19 78.91 75.52 77.51 52.96 50.11 49.24 2.71 2.81 2.44 2.31 2.42 2.22 2.44 3.13 1.80 DBAKER 2
3 IBT_LT 36.25 31.25 50.88 69.92 62.37 70.30 49.67 41.78 47.78 2.68 2.43 2.38 2.48 2.30 2.20 2.54 2.44 2.05 36.25 31.25 50.88 69.92 62.37 70.30 49.67 41.78 47.78 1.77 1.65 2.04 1.76 1.59 1.73 2.05 1.99 1.62 IBT_LT 3
4 FrankensteinLong 36.25 27.92 35.73 60.55 55.34 51.15 36.18 31.58 35.33 2.68 1.88 0.92 1.82 1.79 0.85 0.93 1.01 0.48 40.36 39.17 40.87 83.59 81.77 83.92 36.84 31.58 36.72 2.29 2.75 1.10 2.60 2.81 2.65 0.56 0.59 0.23 FrankensteinLong 4
5 Sternberg 34.64 30.59 51.53 70.31 61.98 68.25 47.70 35.64 51.38 2.43 2.32 2.44 2.51 2.27 2.06 2.31 1.58 2.51 34.64 30.59 51.53 70.31 61.98 68.25 47.70 35.64 51.38 1.57 1.56 2.10 1.79 1.57 1.60 1.82 1.15 2.07 Sternberg 5
6 Phyre_de_novo 34.64 30.59 51.53 70.31 61.98 68.25 47.70 35.64 51.38 2.43 2.32 2.44 2.51 2.27 2.06 2.31 1.58 2.51 34.64 30.59 51.53 70.31 62.11 68.25 47.70 35.64 51.38 1.57 1.56 2.10 1.79 1.57 1.60 1.82 1.15 2.07 Phyre_de_novo 6
7 RAPTOR 34.29 33.09 37.34 69.92 67.58 72.94 15.13 13.60 20.50 2.38 2.73 1.08 2.48 2.68 2.39 -1.59 -1.51 -1.40 43.93 34.29 48.65 69.92 67.58 72.94 47.37 43.20 49.68 2.74 2.07 1.83 1.76 1.92 1.91 1.79 2.18 1.86 RAPTOR 7
8 FALCON_CONSENSUS 33.04 31.84 42.14 66.41 63.28 67.91 27.30 25.33 34.05 2.18 2.53 1.54 2.24 2.37 2.03 -0.13 0.14 0.31 37.32 32.56 43.54 66.41 63.28 67.93 34.87 27.41 43.36 1.90 1.83 1.35 1.55 1.65 1.57 0.33 0.02 1.06 FALCON_CONSENSUS 8
9 FALCON 33.04 31.84 42.14 66.41 63.28 67.91 27.30 25.33 34.05 2.18 2.53 1.54 2.24 2.37 2.03 -0.13 0.14 0.31 33.04 31.84 43.54 66.41 63.28 67.93 34.87 27.41 43.36 1.36 1.73 1.35 1.55 1.65 1.57 0.33 0.02 1.06 FALCON 9
10 Frankenstein 32.50 28.57 33.90 67.19 61.20 67.38 15.46 14.80 19.47 2.10 1.99 0.74 2.29 2.22 2.00 -1.55 -1.34 -1.53 32.50 29.05 34.80 68.75 64.06 70.07 22.70 18.97 28.33 1.30 1.34 0.53 1.69 1.70 1.72 -1.08 -1.14 -0.83 Frankenstein 10
11 3D−JIGSAW_AEP 31.07 28.21 37.00 64.84 59.12 59.05 34.87 29.61 32.64 1.88 1.93 1.04 2.12 2.06 1.41 0.77 0.73 0.13 31.07 28.21 37.00 64.84 59.12 59.05 34.87 29.61 32.83 1.12 1.23 0.73 1.45 1.39 0.98 0.33 0.32 -0.26 3D−JIGSAW_AEP 11
12 3D−JIGSAW_V3 31.07 27.86 30.89 65.23 59.51 60.81 21.05 17.76 19.65 1.88 1.87 0.46 2.15 2.09 1.53 -0.88 -0.92 -1.51 31.07 27.86 34.09 65.23 59.51 64.73 35.53 28.29 28.37 1.12 1.18 0.46 1.47 1.41 1.36 0.41 0.14 -0.82 3D−JIGSAW_V3 12
13 MUSTER 30.71 27.92 40.19 39.84 36.72 41.93 56.25 51.21 54.83 1.82 1.88 1.35 0.35 0.43 0.20 3.33 3.76 2.95 30.71 27.92 40.19 39.84 36.72 41.93 56.25 51.21 54.83 1.07 1.19 1.03 -0.09 -0.02 -0.17 2.82 3.28 2.50 MUSTER 13
14 COMA−M 29.64 23.33 34.70 47.27 42.06 44.81 37.17 30.81 39.33 1.66 1.13 0.82 0.88 0.82 0.40 1.05 0.90 0.98 29.64 24.29 35.75 48.05 43.62 44.99 37.17 32.13 41.08 0.94 0.68 0.62 0.42 0.41 0.03 0.60 0.67 0.78 COMA−M 14
15 MidwayFolding 28.21 26.25 39.02 55.08 49.87 52.41 43.75 36.51 42.93 1.44 1.61 1.24 1.43 1.39 0.94 1.83 1.70 1.44 28.21 26.25 39.02 55.08 49.87 52.41 43.75 37.06 42.93 0.76 0.95 0.92 0.85 0.80 0.53 1.36 1.34 1.01 MidwayFolding 15
16 3DShot2 27.32 20.54 28.35 58.20 43.36 51.87 19.41 18.09 23.83 1.30 0.67 0.21 1.65 0.91 0.90 -1.07 -0.88 -0.98 27.32 20.54 28.35 58.20 43.36 51.87 19.41 18.09 23.83 0.64 0.16 -0.08 1.04 0.39 0.49 -1.47 -1.26 -1.39 3DShot2 16
17 Pcons_local 26.25 24.41 23.92 51.56 45.05 46.82 32.24 28.29 19.97 1.14 1.30 -0.21 1.18 1.04 0.55 0.46 0.55 -1.47 31.43 29.64 23.92 68.75 65.89 66.34 32.24 28.29 19.97 1.16 1.42 -0.49 1.69 1.81 1.47 0.03 0.14 -1.88 Pcons_local 17
18 CpHModels 25.89 24.05 16.15 56.25 52.34 56.89 5.92 3.73 -3.55 1.08 1.24 -0.96 1.52 1.57 1.26 -2.69 -2.89 -4.45 25.89 24.05 16.15 56.25 52.34 56.89 5.92 3.73 -3.55 0.46 0.65 -1.22 0.92 0.96 0.83 -3.03 -3.22 -4.83 CpHModels 18
19 circle 23.04 19.94 33.72 37.50 35.42 39.95 40.46 34.54 42.79 0.64 0.57 0.73 0.19 0.33 0.06 1.44 1.42 1.42 23.04 19.94 33.72 37.89 35.42 40.75 40.46 35.20 42.79 0.11 0.07 0.43 -0.21 -0.11 -0.25 0.98 1.09 0.99 circle 19
20 FAMSD 22.68 18.63 31.75 37.89 33.46 39.73 39.80 32.13 39.66 0.59 0.35 0.54 0.22 0.19 0.05 1.36 1.09 1.02 22.68 18.63 31.75 37.89 33.46 39.73 39.80 32.13 39.66 0.06 -0.11 0.24 -0.21 -0.23 -0.32 0.91 0.67 0.60 FAMSD 20
21 LEE 22.50 19.17 35.97 42.19 39.06 50.35 40.13 33.99 38.62 0.56 0.44 0.94 0.52 0.60 0.79 1.40 1.35 0.89 22.68 19.17 36.41 42.19 39.58 51.91 40.13 33.99 38.81 0.06 -0.03 0.68 0.06 0.16 0.50 0.94 0.92 0.49 LEE 21
22 3DShot1 22.32 14.46 23.50 44.92 27.47 28.16 37.50 29.82 34.47 0.53 -0.33 -0.25 0.71 -0.24 -0.77 1.09 0.76 0.37 22.32 14.46 23.50 44.92 27.47 28.16 37.50 29.82 34.47 0.01 -0.69 -0.53 0.23 -0.61 -1.10 0.64 0.35 -0.05 3DShot1 22
23 SAM−T08−server 21.61 19.58 36.74 42.58 38.15 50.72 36.84 30.70 40.20 0.42 0.51 1.02 0.55 0.53 0.82 1.01 0.89 1.09 26.96 23.99 36.74 58.98 52.73 50.72 36.84 30.70 40.20 0.60 0.64 0.71 1.09 0.98 0.42 0.56 0.47 0.67 SAM−T08−server 23
24 FAMS−multi 21.61 17.32 40.08 41.80 40.23 53.82 37.83 29.71 43.43 0.42 0.14 1.34 0.49 0.69 1.04 1.13 0.75 1.50 22.68 18.16 40.08 41.80 40.23 53.82 39.47 31.14 43.43 0.06 -0.17 1.02 0.03 0.20 0.63 0.87 0.53 1.07 FAMS−multi 24
25 fais−server 21.43 20.95 22.94 46.88 46.09 44.23 18.75 12.39 20.37 0.39 0.73 -0.31 0.85 1.11 0.36 -1.15 -1.67 -1.42 21.43 20.95 33.02 46.88 46.09 47.74 34.87 31.14 35.97 -0.10 0.21 0.36 0.35 0.57 0.22 0.33 0.53 0.13 fais−server 25
26 fams−ace2 21.25 18.21 37.57 42.19 41.15 53.33 36.18 31.80 39.37 0.37 0.28 1.10 0.52 0.75 1.00 0.93 1.04 0.99 34.29 30.95 51.54 69.53 62.76 67.86 47.37 37.28 51.77 1.52 1.61 2.10 1.74 1.61 1.57 1.79 1.37 2.12 fams−ace2 26
27 BAKER−ROBETTA 21.07 20.77 37.66 42.19 41.67 53.63 36.18 32.02 39.31 0.34 0.71 1.11 0.52 0.79 1.03 0.93 1.07 0.98 21.43 20.77 38.34 43.75 41.93 53.63 38.16 33.55 42.17 -0.10 0.19 0.86 0.15 0.30 0.61 0.71 0.86 0.91 BAKER−ROBETTA 27
28 SAM−T08−human 21.07 20.66 37.67 42.19 41.41 53.46 35.53 31.58 39.47 0.34 0.69 1.11 0.52 0.77 1.01 0.85 1.01 1.00 36.79 29.52 48.61 73.83 67.06 73.42 38.16 34.32 41.18 1.84 1.41 1.82 2.00 1.88 1.94 0.71 0.97 0.79 SAM−T08−human 28
29 3DShotMQ 21.07 19.41 34.66 41.80 38.54 49.61 35.20 30.15 37.44 0.34 0.48 0.82 0.49 0.56 0.74 0.81 0.81 0.74 21.07 19.41 34.66 41.80 38.54 49.61 35.20 30.15 37.44 -0.14 -0.00 0.51 0.03 0.09 0.34 0.37 0.39 0.32 3DShotMQ 29
30 mufold 20.89 20.59 37.52 41.80 41.28 53.44 35.85 31.69 39.20 0.31 0.68 1.09 0.49 0.76 1.01 0.89 1.03 0.97 37.32 33.99 43.98 66.41 63.80 67.83 35.85 31.69 39.20 1.90 2.03 1.39 1.55 1.68 1.57 0.45 0.61 0.54 mufold 30
31 Bates_BMM 20.89 20.54 36.93 41.80 41.28 52.48 35.85 31.91 38.97 0.31 0.67 1.04 0.49 0.76 0.94 0.89 1.06 0.94 20.89 20.59 37.04 42.19 41.67 52.61 35.85 31.91 39.05 -0.17 0.16 0.74 0.06 0.29 0.54 0.45 0.64 0.52 Bates_BMM 31
32 EB_AMU_Physics 20.89 18.51 32.69 43.36 39.97 44.36 35.85 31.03 38.19 0.31 0.33 0.63 0.60 0.67 0.37 0.89 0.93 0.84 20.89 18.51 32.69 43.36 39.97 44.36 35.85 31.03 38.19 -0.17 -0.13 0.33 0.13 0.18 -0.01 0.45 0.51 0.41 EB_AMU_Physics 32
33 Zico 20.89 17.92 37.76 42.58 42.06 53.71 35.85 30.59 39.41 0.31 0.24 1.12 0.55 0.82 1.03 0.89 0.87 0.99 23.04 20.95 38.41 44.53 43.23 53.71 40.13 35.09 43.14 0.11 0.21 0.87 0.20 0.39 0.62 0.94 1.07 1.04 Zico 33
34 ZicoFullSTP 20.89 17.92 37.76 42.58 42.06 53.71 35.85 30.59 39.41 0.31 0.24 1.12 0.55 0.82 1.03 0.89 0.87 0.99 21.79 20.95 38.41 44.53 43.23 53.71 38.16 33.99 42.27 -0.05 0.21 0.87 0.20 0.39 0.62 0.71 0.92 0.93 ZicoFullSTP 34
35 ZicoFullSTPFullData 20.89 17.92 37.76 42.58 42.06 53.71 35.85 30.59 39.41 0.31 0.24 1.12 0.55 0.82 1.03 0.89 0.87 0.99 21.79 20.95 38.41 44.53 43.23 53.71 38.16 33.99 42.27 -0.05 0.21 0.87 0.20 0.39 0.62 0.71 0.92 0.93 ZicoFullSTPFullData 35
36 FFASsuboptimal 20.71 17.86 31.77 39.84 38.28 44.49 35.85 31.47 36.74 0.28 0.23 0.54 0.35 0.54 0.38 0.89 0.99 0.65 20.89 19.23 31.95 41.02 38.41 44.49 36.51 34.32 37.88 -0.17 -0.03 0.26 -0.01 0.08 -0.00 0.52 0.97 0.37 FFASsuboptimal 36
37 Poing 20.54 19.17 37.71 40.62 37.50 49.12 35.85 32.13 43.40 0.26 0.44 1.11 0.41 0.49 0.71 0.89 1.09 1.50 32.14 30.18 37.71 65.62 60.16 64.89 40.13 32.13 43.40 1.25 1.50 0.80 1.50 1.45 1.37 0.94 0.67 1.07 Poing 37
38 HHpred2 20.54 18.39 37.12 41.41 36.98 51.34 35.20 31.03 39.91 0.26 0.31 1.05 0.46 0.45 0.86 0.81 0.93 1.06 20.54 18.39 37.12 41.41 36.98 51.34 35.20 31.03 39.91 -0.21 -0.14 0.74 0.01 -0.01 0.46 0.37 0.51 0.63 HHpred2 38
39 GeneSilico 20.18 17.56 34.19 37.89 35.81 48.62 35.53 30.92 37.03 0.20 0.18 0.77 0.22 0.36 0.67 0.85 0.92 0.69 21.79 20.77 37.66 42.19 41.67 53.63 39.80 33.22 39.52 -0.05 0.19 0.80 0.06 0.29 0.61 0.91 0.81 0.58 GeneSilico 39
40 ABIpro 20.18 16.61 38.35 40.62 37.11 54.32 36.51 32.13 39.94 0.20 0.02 1.17 0.41 0.46 1.07 0.97 1.09 1.06 20.18 17.98 38.35 41.41 38.02 54.32 36.51 32.13 40.05 -0.25 -0.20 0.86 0.01 0.06 0.66 0.52 0.67 0.65 ABIpro 40
41 McGuffin 20.18 16.25 38.11 38.67 31.90 49.94 34.87 27.41 43.36 0.20 -0.04 1.15 0.27 0.08 0.77 0.77 0.43 1.49 33.04 31.84 42.14 66.41 63.28 67.91 35.20 31.03 43.36 1.36 1.73 1.22 1.55 1.65 1.57 0.37 0.51 1.06 McGuffin 41
42 GS−MetaServer2 20.00 18.33 28.17 40.62 37.24 39.88 31.91 28.18 33.80 0.17 0.30 0.19 0.41 0.47 0.06 0.42 0.53 0.28 31.61 27.08 30.61 69.14 59.24 62.20 35.85 29.93 35.15 1.18 1.07 0.13 1.71 1.39 1.19 0.45 0.36 0.03 GS−MetaServer2 42
43 GeneSilicoMetaServer 20.00 18.33 28.17 40.62 37.24 39.88 31.91 28.18 33.80 0.17 0.30 0.19 0.41 0.47 0.06 0.42 0.53 0.28 31.61 27.08 30.61 69.14 59.24 62.20 35.85 29.93 35.15 1.18 1.07 0.13 1.71 1.39 1.19 0.45 0.36 0.03 GeneSilicoMetaServer 43
44 Elofsson 20.00 16.07 34.26 32.03 25.78 49.66 31.58 27.19 36.48 0.17 -0.07 0.78 -0.20 -0.37 0.75 0.38 0.40 0.62 20.00 16.07 37.07 38.67 31.64 49.66 34.54 27.41 41.46 -0.28 -0.47 0.74 -0.16 -0.34 0.35 0.29 0.02 0.82 Elofsson 44
45 mGenTHREADER 19.82 17.92 21.33 39.45 37.63 34.70 35.53 32.02 26.96 0.15 0.24 -0.46 0.33 0.50 -0.31 0.85 1.07 -0.59 19.82 17.92 21.33 39.45 37.63 34.70 35.53 32.02 26.96 -0.30 -0.21 -0.74 -0.11 0.03 -0.66 0.41 0.65 -1.00 mGenTHREADER 45
46 Phragment 19.82 17.68 33.37 37.11 33.46 47.10 36.51 32.57 36.03 0.15 0.20 0.69 0.16 0.19 0.56 0.97 1.15 0.56 35.00 31.25 48.58 69.92 68.10 67.74 43.09 32.57 46.30 1.61 1.65 1.82 1.76 1.95 1.56 1.29 0.73 1.43 Phragment 46
47 Phyre2 19.82 17.56 34.86 39.45 36.07 48.34 35.85 32.13 38.86 0.15 0.18 0.84 0.33 0.38 0.65 0.89 1.09 0.92 33.75 31.61 44.26 66.41 62.24 66.70 43.42 32.90 43.97 1.45 1.70 1.41 1.55 1.58 1.49 1.33 0.77 1.14 Phyre2 47
48 keasar−server 19.64 17.38 27.54 34.38 29.69 34.70 36.18 32.02 37.74 0.12 0.15 0.13 -0.03 -0.08 -0.31 0.93 1.07 0.78 34.64 26.67 30.48 46.88 41.93 39.39 39.47 33.55 38.80 1.57 1.01 0.12 0.35 0.30 -0.35 0.87 0.86 0.49 keasar−server 48
49 Jones−UCL 19.64 16.73 35.28 38.28 33.59 49.89 36.51 31.14 37.86 0.12 0.04 0.88 0.24 0.20 0.76 0.97 0.95 0.80 19.64 16.73 35.28 38.28 33.59 49.89 36.51 31.14 37.86 -0.32 -0.37 0.57 -0.18 -0.22 0.36 0.52 0.53 0.37 Jones−UCL 49
50 Zhang−Server 19.11 15.54 34.60 39.45 28.00 50.60 33.22 22.92 36.63 0.04 -0.16 0.81 0.33 -0.21 0.81 0.58 -0.20 0.64 20.54 15.89 37.43 39.45 32.16 51.42 37.17 30.26 40.96 -0.21 -0.49 0.77 -0.11 -0.31 0.46 0.60 0.41 0.76 Zhang−Server 50
51 SAM−T02−server 18.93 17.14 17.30 31.64 28.25 22.98 34.54 31.25 29.99 0.01 0.11 -0.85 -0.23 -0.19 -1.14 0.73 0.96 -0.20 18.93 17.14 17.30 31.64 28.25 22.98 34.54 31.25 29.99 -0.41 -0.32 -1.12 -0.59 -0.56 -1.45 0.29 0.54 -0.62 SAM−T02−server 51
52 FFASstandard 18.93 16.91 27.44 35.55 31.90 46.87 34.54 30.81 26.48 0.01 0.07 0.12 0.05 0.08 0.55 0.73 0.90 -0.65 20.89 16.91 27.44 38.67 35.03 46.87 36.84 30.81 26.48 -0.17 -0.35 -0.16 -0.16 -0.13 0.16 0.56 0.48 -1.06 FFASstandard 52
53 FFASflextemplate 18.93 16.91 27.44 35.55 31.90 46.87 34.54 30.81 26.48 0.01 0.07 0.12 0.05 0.08 0.55 0.73 0.90 -0.65 20.89 16.91 27.44 38.67 35.03 46.87 36.84 30.81 26.48 -0.17 -0.35 -0.16 -0.16 -0.13 0.16 0.56 0.48 -1.06 FFASflextemplate 53
54 TJ_Jiang 18.75 15.95 28.18 33.98 27.73 36.38 32.57 29.06 37.79 -0.02 -0.09 0.20 -0.06 -0.23 -0.19 0.50 0.66 0.79 19.29 16.91 28.38 35.55 29.04 36.38 32.57 29.06 39.42 -0.37 -0.35 -0.08 -0.35 -0.51 -0.55 0.06 0.25 0.57 TJ_Jiang 54
55 Chicken_George 18.75 15.95 24.77 25.78 22.27 29.04 33.88 28.95 38.18 -0.02 -0.09 -0.13 -0.64 -0.62 -0.71 0.65 0.64 0.84 18.93 16.07 27.50 32.81 29.17 33.46 34.87 28.95 39.13 -0.41 -0.47 -0.16 -0.52 -0.50 -0.74 0.33 0.23 0.53 Chicken_George 55
56 GS−KudlatyPred 18.39 14.94 21.89 30.47 23.96 30.73 30.92 24.78 31.26 -0.07 -0.25 -0.41 -0.31 -0.50 -0.59 0.30 0.06 -0.04 38.04 29.58 35.09 60.16 55.73 52.95 36.18 33.77 31.26 1.99 1.42 0.55 1.16 1.17 0.57 0.48 0.89 -0.46 GS−KudlatyPred 56
57 Zhang 18.21 15.65 38.84 38.28 32.42 53.26 32.57 24.45 41.88 -0.10 -0.14 1.22 0.24 0.12 1.00 0.50 0.01 1.31 21.96 18.51 39.30 43.75 43.23 54.54 37.17 30.59 44.10 -0.03 -0.13 0.95 0.15 0.39 0.67 0.60 0.45 1.16 Zhang 57
58 LevittGroup 18.04 15.77 37.84 38.28 34.38 51.48 31.25 24.01 41.63 -0.13 -0.12 1.12 0.24 0.26 0.87 0.34 -0.05 1.27 18.93 16.55 37.84 38.28 34.38 51.48 34.87 29.82 41.63 -0.41 -0.40 0.81 -0.18 -0.17 0.47 0.33 0.35 0.85 LevittGroup 58
59 Wolynes 17.50 14.29 19.21 27.34 24.74 32.50 28.29 23.36 24.13 -0.21 -0.36 -0.67 -0.53 -0.44 -0.46 -0.01 -0.14 -0.94 17.50 14.46 26.12 32.81 27.34 35.66 28.29 23.36 34.35 -0.59 -0.69 -0.29 -0.52 -0.61 -0.60 -0.43 -0.54 -0.07 Wolynes 59
60 SMEG−CCP 17.32 13.87 32.79 36.33 29.56 48.21 23.03 17.11 34.81 -0.24 -0.43 0.64 0.11 -0.09 0.64 -0.64 -1.01 0.41 17.32 13.87 32.79 36.33 29.56 48.21 23.03 17.11 34.81 -0.61 -0.77 0.34 -0.30 -0.47 0.25 -1.04 -1.39 -0.01 SMEG−CCP 60
61 METATASSER 16.79 13.69 30.17 37.50 30.73 47.47 24.34 19.52 31.04 -0.32 -0.46 0.39 0.19 -0.01 0.59 -0.49 -0.68 -0.07 19.46 16.55 32.18 37.50 31.38 47.47 32.57 27.96 38.14 -0.35 -0.40 0.28 -0.23 -0.36 0.20 0.06 0.09 0.41 METATASSER 61
62 Zhou−SPARKS 16.61 12.98 23.09 32.42 23.57 31.22 26.32 21.71 33.06 -0.35 -0.58 -0.29 -0.17 -0.53 -0.55 -0.25 -0.37 0.19 16.61 12.98 23.09 32.42 23.57 31.22 26.32 21.71 33.06 -0.70 -0.90 -0.57 -0.54 -0.85 -0.89 -0.66 -0.76 -0.23 Zhou−SPARKS 62
63 PS2−server 16.43 13.81 18.25 20.31 18.88 21.61 27.63 24.56 30.99 -0.38 -0.44 -0.76 -1.03 -0.87 -1.23 -0.09 0.03 -0.07 16.43 13.81 24.75 27.73 23.05 37.95 28.62 24.56 33.18 -0.73 -0.78 -0.42 -0.83 -0.88 -0.44 -0.39 -0.37 -0.22 PS2−server 63
64 PS2−manual 16.43 13.81 18.25 20.31 18.88 21.61 27.63 24.56 30.99 -0.38 -0.44 -0.76 -1.03 -0.87 -1.23 -0.09 0.03 -0.07 16.43 13.81 24.75 25.00 22.14 37.95 28.62 24.56 33.18 -0.73 -0.78 -0.42 -1.00 -0.94 -0.44 -0.39 -0.37 -0.22 PS2−manual 64
65 Sasaki−Cetin−Sasai 16.25 15.36 27.17 32.03 29.69 41.24 21.38 19.19 30.65 -0.40 -0.18 0.10 -0.20 -0.08 0.15 -0.84 -0.72 -0.12 19.11 17.56 31.27 37.89 32.16 41.24 34.54 32.13 42.16 -0.39 -0.26 0.20 -0.21 -0.31 -0.22 0.29 0.67 0.91 Sasaki−Cetin−Sasai 65
66 PSI 16.25 14.94 27.70 27.34 24.48 38.24 26.32 23.46 35.20 -0.40 -0.25 0.15 -0.53 -0.46 -0.06 -0.25 -0.13 0.46 16.25 14.94 28.56 28.12 25.52 40.29 26.32 23.46 35.20 -0.75 -0.62 -0.06 -0.81 -0.73 -0.28 -0.66 -0.52 0.04 PSI 66
67 SAINT1 16.25 12.62 21.17 26.17 20.83 32.89 25.66 22.15 28.01 -0.40 -0.64 -0.48 -0.61 -0.73 -0.44 -0.33 -0.31 -0.45 16.25 12.62 21.17 26.17 20.83 32.89 25.66 22.15 28.01 -0.75 -0.95 -0.75 -0.93 -1.02 -0.78 -0.74 -0.70 -0.87 SAINT1 67
68 POEMQA 15.89 12.62 14.26 21.48 17.19 20.91 20.39 17.54 26.13 -0.46 -0.64 -1.14 -0.95 -0.99 -1.28 -0.96 -0.95 -0.69 15.89 13.10 14.26 21.48 18.36 20.91 20.72 18.31 26.13 -0.79 -0.88 -1.40 -1.22 -1.18 -1.59 -1.31 -1.23 -1.10 POEMQA 68
69 DistillSN 15.89 12.44 19.97 26.17 20.96 34.29 28.29 21.49 24.10 -0.46 -0.67 -0.59 -0.61 -0.72 -0.34 -0.01 -0.40 -0.95 15.89 12.44 19.97 26.17 21.75 34.29 28.29 23.90 26.47 -0.79 -0.97 -0.86 -0.93 -0.97 -0.69 -0.43 -0.46 -1.06 DistillSN 69
70 keasar 15.71 14.23 26.33 27.73 24.35 43.98 21.05 17.98 27.34 -0.49 -0.37 0.02 -0.50 -0.47 0.34 -0.88 -0.89 -0.54 17.86 15.42 30.38 27.73 25.13 43.98 31.91 27.52 40.76 -0.55 -0.56 0.11 -0.83 -0.75 -0.04 -0.01 0.03 0.74 keasar 70
71 JIVE08 15.71 14.23 25.89 27.73 25.13 41.72 24.67 21.16 28.61 -0.49 -0.37 -0.02 -0.50 -0.42 0.19 -0.45 -0.45 -0.38 15.71 14.23 25.89 27.73 25.13 41.72 24.67 21.16 28.61 -0.82 -0.72 -0.31 -0.83 -0.75 -0.19 -0.85 -0.84 -0.79 JIVE08 71
72 MULTICOM 15.71 12.56 13.83 21.09 15.62 20.35 19.74 16.56 25.86 -0.49 -0.65 -1.18 -0.97 -1.11 -1.32 -1.04 -1.09 -0.72 21.79 20.71 38.69 44.53 42.71 53.91 37.83 31.69 42.04 -0.05 0.18 0.89 0.20 0.35 0.63 0.68 0.61 0.90 MULTICOM 72
73 MUProt 15.71 12.50 14.05 21.09 17.84 20.58 19.74 17.11 26.07 -0.49 -0.66 -1.16 -0.97 -0.95 -1.31 -1.04 -1.01 -0.70 15.71 12.50 14.23 21.48 17.84 20.89 21.05 17.87 26.11 -0.82 -0.96 -1.40 -1.22 -1.21 -1.59 -1.27 -1.29 -1.10 MUProt 73
74 AMU−Biology 15.54 14.94 20.71 23.05 19.14 27.62 28.29 27.19 31.85 -0.51 -0.25 -0.52 -0.84 -0.85 -0.81 -0.01 0.40 0.03 15.54 14.94 20.71 23.05 19.14 27.62 28.29 27.19 31.85 -0.84 -0.62 -0.80 -1.12 -1.13 -1.14 -0.43 -0.01 -0.38 AMU−Biology 74
75 Handl−Lovell 15.54 14.11 22.38 23.83 19.53 32.62 26.64 24.01 30.12 -0.51 -0.39 -0.36 -0.78 -0.82 -0.46 -0.21 -0.05 -0.18 15.54 14.11 25.50 29.30 25.65 41.09 26.64 24.01 30.28 -0.84 -0.74 -0.35 -0.73 -0.72 -0.23 -0.63 -0.45 -0.58 Handl−Lovell 75
76 LOOPP_Server 15.54 12.92 9.01 18.36 15.76 9.54 28.29 22.81 27.16 -0.51 -0.59 -1.65 -1.17 -1.10 -2.08 -0.01 -0.22 -0.56 15.54 13.04 16.42 26.95 23.57 29.97 28.29 22.81 27.16 -0.84 -0.89 -1.20 -0.88 -0.85 -0.98 -0.43 -0.61 -0.97 LOOPP_Server 76
77 MULTICOM−RANK 15.54 12.80 12.80 19.92 14.45 20.00 21.05 18.53 24.30 -0.51 -0.61 -1.28 -1.06 -1.19 -1.35 -0.88 -0.82 -0.92 17.68 15.30 14.54 22.27 19.66 25.58 22.04 18.64 26.82 -0.57 -0.57 -1.37 -1.17 -1.10 -1.27 -1.16 -1.18 -1.02 MULTICOM−RANK 77
78 MULTICOM−CLUSTER 15.54 12.68 12.98 20.31 15.10 20.11 21.05 18.64 24.53 -0.51 -0.63 -1.26 -1.03 -1.15 -1.34 -0.88 -0.80 -0.89 17.86 15.60 14.76 22.27 20.31 25.78 22.37 19.08 26.98 -0.55 -0.53 -1.35 -1.17 -1.06 -1.26 -1.12 -1.12 -1.00 MULTICOM−CLUSTER 78
79 MULTICOM−REFINE 15.54 12.44 13.90 21.09 15.76 20.68 20.07 17.65 25.68 -0.51 -0.67 -1.18 -0.97 -1.10 -1.30 -1.00 -0.94 -0.75 18.39 15.30 14.73 22.66 21.35 22.43 22.04 18.97 26.85 -0.48 -0.57 -1.36 -1.14 -0.99 -1.49 -1.16 -1.14 -1.01 MULTICOM−REFINE 79
80 MUFOLD−Server 15.36 12.92 20.01 23.05 21.22 28.78 26.32 22.15 29.48 -0.54 -0.59 -0.59 -0.84 -0.70 -0.73 -0.25 -0.31 -0.27 15.36 13.63 23.61 30.47 25.78 38.43 27.30 24.56 29.48 -0.86 -0.81 -0.52 -0.66 -0.71 -0.41 -0.55 -0.37 -0.68 MUFOLD−Server 80
81 pro−sp3−TASSER 15.18 13.63 29.99 28.52 24.09 36.54 24.67 21.60 40.83 -0.57 -0.47 0.37 -0.45 -0.49 -0.18 -0.45 -0.39 1.17 21.61 20.89 36.59 44.53 43.49 49.99 36.18 30.48 40.83 -0.07 0.21 0.69 0.20 0.40 0.37 0.48 0.44 0.74 pro−sp3−TASSER 81
82 MULTICOM−CMFR 14.82 12.80 14.28 21.48 17.97 22.07 17.76 15.02 25.09 -0.63 -0.61 -1.14 -0.95 -0.94 -1.20 -1.27 -1.31 -0.82 15.54 12.80 14.28 21.88 17.97 25.85 20.72 18.20 25.83 -0.84 -0.92 -1.40 -1.19 -1.20 -1.26 -1.31 -1.24 -1.14 MULTICOM−CMFR 82
83 Kolinski 14.64 13.57 23.30 26.56 20.57 28.80 26.97 25.22 35.55 -0.65 -0.48 -0.27 -0.59 -0.75 -0.73 -0.17 0.12 0.50 18.39 14.94 29.94 32.81 28.12 40.36 33.55 27.19 37.24 -0.48 -0.62 0.07 -0.52 -0.57 -0.28 0.18 -0.01 0.29 Kolinski 83
84 SHORTLE 14.64 13.39 10.04 30.86 26.95 21.81 21.05 18.75 17.71 -0.65 -0.51 -1.55 -0.28 -0.28 -1.22 -0.88 -0.78 -1.76 15.36 13.69 11.33 30.86 26.95 21.81 23.03 18.75 23.15 -0.86 -0.80 -1.68 -0.64 -0.64 -1.53 -1.04 -1.17 -1.48 SHORTLE 84
85 TWPPLAB 14.46 13.57 17.11 25.39 23.31 25.11 20.39 17.00 26.48 -0.68 -0.48 -0.87 -0.67 -0.55 -0.99 -0.96 -1.03 -0.65 14.46 13.57 17.11 25.39 23.31 25.11 20.39 17.00 26.48 -0.97 -0.81 -1.13 -0.97 -0.87 -1.31 -1.35 -1.41 -1.06 TWPPLAB 85
86 MUFOLD−MD 14.46 13.15 20.18 23.44 20.31 30.28 24.01 22.04 28.60 -0.68 -0.55 -0.57 -0.81 -0.77 -0.62 -0.53 -0.32 -0.38 16.61 13.21 26.51 33.20 26.69 39.75 24.01 22.04 34.94 -0.70 -0.86 -0.25 -0.49 -0.66 -0.32 -0.93 -0.72 0.00 MUFOLD−MD 86
87 A−TASSER 14.29 12.98 26.80 27.73 23.83 33.71 23.68 21.05 37.63 -0.71 -0.58 0.06 -0.50 -0.51 -0.38 -0.56 -0.46 0.77 21.25 19.46 35.28 43.75 40.62 48.43 35.53 30.92 39.54 -0.12 0.01 0.57 0.15 0.22 0.26 0.41 0.50 0.58 A−TASSER 87
88 COMA 14.29 12.08 15.46 22.66 19.53 26.30 19.08 17.76 23.35 -0.71 -0.72 -1.03 -0.86 -0.82 -0.90 -1.11 -0.92 -1.04 28.39 24.29 35.75 48.05 43.62 44.99 37.17 32.13 41.08 0.78 0.68 0.62 0.42 0.41 0.03 0.60 0.67 0.78 COMA 88
89 FLOUDAS 14.29 11.73 18.17 30.08 26.43 30.13 23.03 21.16 25.04 -0.71 -0.78 -0.77 -0.34 -0.32 -0.63 -0.64 -0.45 -0.83 14.82 12.62 25.71 30.08 26.43 36.98 25.66 21.16 32.80 -0.93 -0.95 -0.33 -0.69 -0.67 -0.51 -0.74 -0.84 -0.26 FLOUDAS 89
90 RBO−Proteus 14.11 12.98 25.15 27.34 24.87 40.93 21.38 17.21 27.98 -0.73 -0.58 -0.10 -0.53 -0.43 0.13 -0.84 -1.00 -0.46 19.11 17.14 31.54 28.52 25.52 44.83 33.88 30.26 42.33 -0.39 -0.32 0.22 -0.78 -0.73 0.02 0.22 0.41 0.93 RBO−Proteus 90
91 BioSerf 13.93 12.56 23.43 27.73 21.75 36.26 25.00 22.26 29.14 -0.76 -0.65 -0.26 -0.50 -0.66 -0.20 -0.41 -0.29 -0.31 13.93 12.56 23.43 27.73 21.75 36.26 25.00 22.26 29.14 -1.04 -0.95 -0.54 -0.83 -0.97 -0.56 -0.82 -0.69 -0.72 BioSerf 91
92 RANDOM 13.91 11.06 13.91 24.94 20.93 24.94 22.93 19.11 22.93 -0.77 -0.89 -1.18 -0.70 -0.72 -1.00 -0.65 -0.73 -1.10 13.91 11.06 13.91 24.94 20.93 24.94 22.93 19.11 22.93 -1.04 -1.16 -1.43 -1.00 -1.02 -1.32 -1.06 -1.12 -1.50 RANDOM 92
93 Distill 13.57 11.79 24.99 26.17 20.70 31.65 25.33 21.60 35.26 -0.82 -0.77 -0.11 -0.61 -0.74 -0.52 -0.37 -0.39 0.47 14.82 12.20 24.99 26.17 21.48 35.75 25.99 22.70 35.26 -0.93 -1.01 -0.39 -0.93 -0.98 -0.59 -0.70 -0.63 0.05 Distill 93
94 nFOLD3 13.39 11.79 19.35 23.44 19.79 27.43 24.01 21.05 28.60 -0.85 -0.77 -0.65 -0.81 -0.81 -0.82 -0.53 -0.46 -0.38 19.82 18.99 27.20 41.80 40.49 42.34 27.63 21.49 31.89 -0.30 -0.06 -0.19 0.03 0.21 -0.15 -0.51 -0.79 -0.38 nFOLD3 94
95 FEIG 13.21 11.55 18.11 21.48 18.62 25.48 21.71 18.53 28.17 -0.87 -0.81 -0.77 -0.95 -0.89 -0.96 -0.80 -0.82 -0.43 20.54 18.04 27.45 40.23 35.29 44.37 26.97 22.81 32.22 -0.21 -0.19 -0.16 -0.06 -0.11 -0.01 -0.59 -0.61 -0.34 FEIG 95
96 HHpred5 13.21 11.49 13.45 19.92 17.19 23.01 23.36 19.85 22.85 -0.87 -0.82 -1.22 -1.06 -0.99 -1.13 -0.60 -0.63 -1.11 13.21 11.49 13.45 19.92 17.19 23.01 23.36 19.85 22.85 -1.13 -1.10 -1.48 -1.31 -1.25 -1.45 -1.01 -1.02 -1.51 HHpred5 96
97 Scheraga 13.21 10.83 17.57 22.66 19.92 26.12 23.03 18.64 27.81 -0.87 -0.93 -0.82 -0.86 -0.80 -0.91 -0.64 -0.80 -0.48 17.86 14.88 19.41 25.39 21.09 32.90 23.68 19.63 27.81 -0.55 -0.63 -0.92 -0.97 -1.01 -0.78 -0.97 -1.05 -0.89 Scheraga 97
98 HHpred4 13.04 9.70 15.92 19.53 17.45 21.90 20.72 17.98 28.33 -0.90 -1.12 -0.98 -1.08 -0.98 -1.21 -0.92 -0.89 -0.41 13.04 9.70 15.92 19.53 17.45 21.90 20.72 17.98 28.33 -1.15 -1.35 -1.24 -1.33 -1.24 -1.52 -1.31 -1.27 -0.83 HHpred4 98
99 POISE 12.68 11.85 15.73 23.05 21.75 25.34 20.72 18.75 24.35 -0.95 -0.76 -1.00 -0.84 -0.66 -0.97 -0.92 -0.78 -0.92 15.89 14.23 17.40 26.17 21.75 27.38 22.04 19.63 27.60 -0.79 -0.72 -1.11 -0.93 -0.97 -1.15 -1.16 -1.05 -0.92 POISE 99
100 forecast 12.68 11.37 15.16 24.22 19.53 26.73 18.42 15.68 21.67 -0.95 -0.84 -1.06 -0.75 -0.82 -0.87 -1.19 -1.21 -1.26 13.39 12.14 15.83 24.61 23.57 27.63 19.74 17.43 22.67 -1.11 -1.01 -1.25 -1.02 -0.85 -1.14 -1.43 -1.35 -1.54 forecast 100
101 mariner1 12.68 10.60 15.08 22.27 17.58 26.16 21.38 14.36 22.80 -0.95 -0.97 -1.06 -0.89 -0.97 -0.91 -0.84 -1.40 -1.11 12.86 11.07 15.53 24.61 21.75 29.06 22.70 18.31 22.80 -1.18 -1.16 -1.28 -1.02 -0.97 -1.04 -1.08 -1.23 -1.52 mariner1 101
102 PRI−Yang−KiharA 12.50 10.60 14.56 25.78 21.61 26.16 18.42 15.46 21.66 -0.98 -0.97 -1.11 -0.64 -0.67 -0.91 -1.19 -1.25 -1.26 12.50 10.60 14.56 25.78 21.61 26.16 18.42 15.46 21.66 -1.22 -1.23 -1.37 -0.95 -0.97 -1.24 -1.58 -1.62 -1.66 PRI−Yang−KiharA 102
103 Pcons_dot_net 12.32 8.99 14.70 21.48 16.54 25.05 20.39 18.97 23.22 -1.01 -1.23 -1.10 -0.95 -1.04 -0.99 -0.96 -0.75 -1.06 32.32 30.66 24.86 69.92 66.28 68.33 29.93 22.26 34.14 1.27 1.57 -0.41 1.76 1.84 1.60 -0.24 -0.69 -0.10 Pcons_dot_net 103
104 Pcons_multi 12.32 8.99 14.70 21.48 16.54 25.05 20.39 18.97 23.22 -1.01 -1.23 -1.10 -0.95 -1.04 -0.99 -0.96 -0.75 -1.06 16.43 11.73 23.68 27.34 20.05 35.79 30.59 23.36 33.32 -0.73 -1.07 -0.52 -0.85 -1.07 -0.59 -0.17 -0.54 -0.20 Pcons_multi 104
105 Bilab−UT 12.14 11.25 16.08 21.48 18.10 25.24 21.38 18.75 25.10 -1.04 -0.86 -0.97 -0.95 -0.93 -0.98 -0.84 -0.78 -0.82 15.54 13.04 23.66 30.86 25.13 35.05 29.28 25.66 32.53 -0.84 -0.89 -0.52 -0.64 -0.75 -0.64 -0.32 -0.22 -0.30 Bilab−UT 105
106 schenk−torda−server 12.14 10.36 13.15 19.14 16.28 24.29 19.08 17.76 21.08 -1.04 -1.01 -1.25 -1.11 -1.06 -1.04 -1.11 -0.92 -1.33 12.14 10.36 14.20 23.83 19.92 24.29 21.05 17.76 24.24 -1.27 -1.26 -1.41 -1.07 -1.08 -1.36 -1.27 -1.30 -1.34 schenk−torda−server 106
107 igor 12.14 10.36 7.75 21.48 18.49 16.37 18.75 15.68 18.53 -1.04 -1.01 -1.77 -0.95 -0.90 -1.60 -1.15 -1.21 -1.65 12.14 10.36 7.75 21.48 18.49 16.37 18.75 15.68 18.53 -1.27 -1.26 -2.01 -1.22 -1.17 -1.89 -1.54 -1.59 -2.06 igor 107
108 Softberry 12.14 9.64 5.59 26.95 18.75 28.40 15.79 11.18 3.43 -1.04 -1.13 -1.97 -0.56 -0.88 -0.75 -1.51 -1.84 -3.57 12.14 9.64 5.59 26.95 18.75 28.40 15.79 11.18 3.43 -1.27 -1.36 -2.21 -0.88 -1.15 -1.08 -1.89 -2.20 -3.95 Softberry 108
109 3Dpro 11.79 10.00 11.02 19.53 16.67 20.98 19.41 17.43 20.05 -1.09 -1.07 -1.45 -1.08 -1.03 -1.28 -1.07 -0.97 -1.46 12.14 11.25 13.08 19.53 16.67 22.75 20.07 19.52 23.33 -1.27 -1.14 -1.51 -1.33 -1.29 -1.46 -1.39 -1.06 -1.45 3Dpro 109
110 CBSU 11.61 10.42 15.15 20.31 16.54 24.06 21.38 19.19 24.59 -1.12 -1.00 -1.06 -1.03 -1.04 -1.06 -0.84 -0.72 -0.89 13.21 11.31 19.45 21.48 17.84 24.30 24.34 20.61 35.27 -1.13 -1.13 -0.91 -1.22 -1.21 -1.36 -0.89 -0.91 0.05 CBSU 110
111 SAM−T06−server 11.61 10.24 11.10 21.09 17.45 20.90 18.75 15.35 20.31 -1.12 -1.03 -1.45 -0.97 -0.98 -1.28 -1.15 -1.26 -1.43 35.89 28.39 23.35 45.70 42.32 33.74 40.46 34.32 28.92 1.72 1.25 -0.55 0.27 0.33 -0.73 0.98 0.97 -0.75 SAM−T06−server 111
112 Hao_Kihara 11.61 10.00 17.72 22.27 19.92 30.41 19.08 16.45 23.92 -1.12 -1.07 -0.81 -0.89 -0.80 -0.61 -1.11 -1.11 -0.97 30.00 24.88 32.16 40.23 37.63 46.45 55.26 45.83 53.46 0.98 0.76 0.28 -0.06 0.03 0.13 2.70 2.54 2.33 Hao_Kihara 112
113 MeilerLabRene 11.61 10.00 13.18 17.58 14.84 21.03 21.71 18.64 24.23 -1.12 -1.07 -1.25 -1.22 -1.17 -1.27 -0.80 -0.80 -0.93 14.11 11.96 13.80 19.14 16.02 22.95 25.99 22.26 24.23 -1.02 -1.04 -1.44 -1.36 -1.33 -1.45 -0.70 -0.69 -1.34 MeilerLabRene 113
114 ACOMPMOD 11.43 10.24 7.12 21.88 18.75 11.33 17.76 15.24 21.78 -1.15 -1.03 -1.83 -0.92 -0.88 -1.96 -1.27 -1.28 -1.24 19.64 18.81 18.16 42.97 41.15 44.17 23.03 19.41 32.80 -0.32 -0.08 -1.03 0.11 0.25 -0.02 -1.04 -1.08 -0.26 ACOMPMOD 114
115 Jiang_Zhu 11.43 10.06 12.61 22.66 19.53 25.37 19.08 16.23 19.10 -1.15 -1.06 -1.30 -0.86 -0.82 -0.97 -1.11 -1.14 -1.58 11.43 10.06 12.61 22.66 19.53 25.37 19.08 16.23 19.10 -1.36 -1.30 -1.56 -1.14 -1.11 -1.29 -1.50 -1.51 -1.99 Jiang_Zhu 115
116 mahmood−torda−server 11.43 9.70 13.37 16.80 12.37 22.22 17.76 12.94 23.60 -1.15 -1.12 -1.23 -1.28 -1.35 -1.19 -1.27 -1.60 -1.01 12.14 10.54 13.37 18.36 15.23 23.77 19.74 17.43 23.60 -1.27 -1.24 -1.48 -1.41 -1.38 -1.40 -1.43 -1.35 -1.42 mahmood−torda−server 116
117 fleil 11.43 9.17 14.64 18.75 15.37 23.92 19.41 16.45 24.25 -1.15 -1.20 -1.11 -1.14 -1.13 -1.07 -1.07 -1.11 -0.93 11.79 11.07 14.96 19.14 15.76 24.48 20.07 18.20 24.34 -1.31 -1.16 -1.33 -1.36 -1.34 -1.35 -1.39 -1.24 -1.33 fleil 117
118 SAMUDRALA 11.25 8.75 14.16 12.50 11.33 20.89 17.76 14.47 26.01 -1.18 -1.27 -1.15 -1.58 -1.42 -1.28 -1.27 -1.38 -0.71 12.14 9.64 14.16 17.58 14.19 20.89 18.09 16.12 26.01 -1.27 -1.36 -1.41 -1.45 -1.44 -1.59 -1.62 -1.53 -1.12 SAMUDRALA 118
119 ProtAnG 11.07 10.24 12.59 20.31 16.80 22.85 18.42 16.45 21.22 -1.20 -1.03 -1.30 -1.03 -1.02 -1.15 -1.19 -1.11 -1.31 11.07 10.24 12.59 20.31 16.80 22.85 18.42 16.45 21.22 -1.40 -1.28 -1.56 -1.29 -1.28 -1.46 -1.58 -1.48 -1.72 ProtAnG 119
120 POEM 11.07 9.23 13.95 19.92 17.06 25.76 19.08 16.12 21.35 -1.20 -1.19 -1.17 -1.06 -1.00 -0.94 -1.11 -1.15 -1.30 12.32 11.19 14.26 19.92 17.06 25.76 19.08 16.12 26.13 -1.24 -1.15 -1.40 -1.31 -1.26 -1.26 -1.50 -1.53 -1.10 POEM 120
121 xianmingpan 10.71 9.88 10.34 22.66 20.83 29.90 13.49 11.73 10.71 -1.26 -1.09 -1.52 -0.86 -0.73 -0.65 -1.78 -1.77 -2.65 10.71 9.88 10.34 22.66 20.83 29.90 13.49 11.73 10.71 -1.45 -1.33 -1.77 -1.14 -1.02 -0.98 -2.15 -2.13 -3.04 xianmingpan 121
122 pipe_int 10.71 8.75 16.36 19.14 15.88 25.49 19.74 16.67 26.03 -1.26 -1.27 -0.94 -1.11 -1.09 -0.96 -1.04 -1.08 -0.70 10.71 8.75 16.36 19.14 15.88 25.49 19.74 16.67 26.03 -1.45 -1.49 -1.20 -1.36 -1.34 -1.28 -1.43 -1.45 -1.11 pipe_int 122
123 FOLDpro 10.54 9.23 13.08 16.41 14.45 22.75 17.76 15.35 22.48 -1.28 -1.19 -1.26 -1.31 -1.19 -1.15 -1.27 -1.26 -1.15 12.14 11.25 13.08 19.53 16.67 22.75 20.07 19.52 23.33 -1.27 -1.14 -1.51 -1.33 -1.29 -1.46 -1.39 -1.06 -1.45 FOLDpro 123
124 StruPPi 10.54 8.69 13.67 19.53 16.15 23.61 17.43 13.27 22.60 -1.28 -1.28 -1.20 -1.08 -1.07 -1.09 -1.31 -1.55 -1.14 10.54 8.69 13.67 19.53 16.15 23.61 17.43 13.27 22.60 -1.47 -1.49 -1.46 -1.33 -1.32 -1.41 -1.70 -1.92 -1.55 StruPPi 124
125 OLGAFS 10.36 9.40 7.89 21.48 18.36 23.03 18.75 16.56 12.85 -1.31 -1.16 -1.75 -0.95 -0.91 -1.13 -1.15 -1.09 -2.37 10.36 9.40 8.06 21.48 18.36 23.26 18.75 16.56 13.26 -1.49 -1.40 -1.98 -1.22 -1.18 -1.43 -1.54 -1.47 -2.72 OLGAFS 125
126 psiphifoldings 10.36 8.69 12.06 19.14 15.23 22.74 16.12 14.91 20.59 -1.31 -1.28 -1.35 -1.11 -1.14 -1.15 -1.47 -1.32 -1.39 10.36 8.93 12.10 19.14 16.41 22.82 16.12 14.91 20.59 -1.49 -1.46 -1.60 -1.36 -1.30 -1.46 -1.85 -1.69 -1.80 psiphifoldings 126
127 panther_server 10.18 9.58 2.81 13.67 10.42 7.25 18.75 15.68 17.91 -1.34 -1.14 -2.24 -1.50 -1.49 -2.25 -1.15 -1.21 -1.73 10.18 9.58 2.81 13.67 10.42 7.25 18.75 15.68 17.91 -1.51 -1.37 -2.47 -1.70 -1.68 -2.51 -1.54 -1.59 -2.14 panther_server 127
128 FUGUE_KM 9.64 8.93 -3.91 21.09 19.79 18.75 0.00 0.00 -4.78 -1.42 -1.24 -2.89 -0.97 -0.81 -1.43 -3.40 -3.41 -4.61 19.64 18.33 11.30 42.97 40.37 31.63 17.11 14.25 20.37 -0.32 -0.15 -1.68 0.11 0.21 -0.87 -1.73 -1.78 -1.83 FUGUE_KM 128
129 DelCLab 9.29 8.27 13.48 18.75 14.84 23.70 16.12 14.36 22.28 -1.48 -1.35 -1.22 -1.14 -1.17 -1.09 -1.47 -1.40 -1.18 11.96 10.00 14.89 21.88 16.67 24.61 19.41 14.69 22.95 -1.29 -1.31 -1.34 -1.19 -1.29 -1.34 -1.47 -1.72 -1.50 DelCLab 129
130 Pushchino 4.64 3.57 -11.99 10.16 7.81 2.61 0.00 0.00 -4.78 -2.19 -2.12 -3.66 -1.75 -1.68 -2.57 -3.40 -3.41 -4.61 4.64 3.57 -11.99 10.16 7.81 2.61 0.00 0.00 -4.78 -2.21 -2.21 -3.86 -1.91 -1.84 -2.82 -3.72 -3.73 -4.99 Pushchino 130
131 rehtnap 0.00 0.00 -13.49 0.00 0.00 -0.39 0.00 0.00 -4.78 -2.91 -2.71 -3.81 -2.47 -2.25 -2.78 -3.40 -3.41 -4.61 0.00 0.00 -13.49 0.00 0.00 -0.39 0.00 0.00 -4.78 -2.80 -2.71 -4.00 -2.54 -2.33 -3.02 -3.72 -3.73 -4.99 rehtnap 131
132 Abagyan                                                       -0.77 -0.89 -1.18 -0.70 -0.72 -1.00 -0.65 -0.73 -1.10                                                       -1.04 -1.16 -1.43 -1.00 -1.02 -1.32 -1.06 -1.12 -1.50 Abagyan 132
133 BHAGEERATH                                                       -0.77 -0.89 -1.18 -0.70 -0.72 -1.00 -0.65 -0.73 -1.10                                                       -1.04 -1.16 -1.43 -1.00 -1.02 -1.32 -1.06 -1.12 -1.50 BHAGEERATH 133
134 FEIG_REFINE                                                       -0.77 -0.89 -1.18 -0.70 -0.72 -1.00 -0.65 -0.73 -1.10                                                       -1.04 -1.16 -1.43 -1.00 -1.02 -1.32 -1.06 -1.12 -1.50 FEIG_REFINE 134
135 Fiser−M4T                                                       -0.77 -0.89 -1.18 -0.70 -0.72 -1.00 -0.65 -0.73 -1.10                                                       -1.04 -1.16 -1.43 -1.00 -1.02 -1.32 -1.06 -1.12 -1.50 Fiser−M4T 135
136 HCA                                                       -0.77 -0.89 -1.18 -0.70 -0.72 -1.00 -0.65 -0.73 -1.10                                                       -1.04 -1.16 -1.43 -1.00 -1.02 -1.32 -1.06 -1.12 -1.50 HCA 136
137 KudlatyPredHuman                                                       -0.77 -0.89 -1.18 -0.70 -0.72 -1.00 -0.65 -0.73 -1.10                                                       -1.04 -1.16 -1.43 -1.00 -1.02 -1.32 -1.06 -1.12 -1.50 KudlatyPredHuman 137
138 LEE−SERVER                                                       -0.77 -0.89 -1.18 -0.70 -0.72 -1.00 -0.65 -0.73 -1.10                                                       -1.04 -1.16 -1.43 -1.00 -1.02 -1.32 -1.06 -1.12 -1.50 LEE−SERVER 138
139 Linnolt−UH−CMB                                                       -0.77 -0.89 -1.18 -0.70 -0.72 -1.00 -0.65 -0.73 -1.10                                                       -1.04 -1.16 -1.43 -1.00 -1.02 -1.32 -1.06 -1.12 -1.50 Linnolt−UH−CMB 139
140 NIM2                                                       -0.77 -0.89 -1.18 -0.70 -0.72 -1.00 -0.65 -0.73 -1.10                                                       -1.04 -1.16 -1.43 -1.00 -1.02 -1.32 -1.06 -1.12 -1.50 NIM2 140
141 Nano_team                                                       -0.77 -0.89 -1.18 -0.70 -0.72 -1.00 -0.65 -0.73 -1.10                                                       -1.04 -1.16 -1.43 -1.00 -1.02 -1.32 -1.06 -1.12 -1.50 Nano_team 141
142 NirBenTal                                                       -0.77 -0.89 -1.18 -0.70 -0.72 -1.00 -0.65 -0.73 -1.10                                                       -1.04 -1.16 -1.43 -1.00 -1.02 -1.32 -1.06 -1.12 -1.50 NirBenTal 142
143 Ozkan−Shell                                                       -0.77 -0.89 -1.18 -0.70 -0.72 -1.00 -0.65 -0.73 -1.10                                                       -1.04 -1.16 -1.43 -1.00 -1.02 -1.32 -1.06 -1.12 -1.50 Ozkan−Shell 143
144 PHAISTOS                                                       -0.77 -0.89 -1.18 -0.70 -0.72 -1.00 -0.65 -0.73 -1.10                                                       -1.04 -1.16 -1.43 -1.00 -1.02 -1.32 -1.06 -1.12 -1.50 PHAISTOS 144
145 PZ−UAM                                                       -0.77 -0.89 -1.18 -0.70 -0.72 -1.00 -0.65 -0.73 -1.10                                                       -1.04 -1.16 -1.43 -1.00 -1.02 -1.32 -1.06 -1.12 -1.50 PZ−UAM 145
146 ProteinShop                                                       -0.77 -0.89 -1.18 -0.70 -0.72 -1.00 -0.65 -0.73 -1.10                                                       -1.04 -1.16 -1.43 -1.00 -1.02 -1.32 -1.06 -1.12 -1.50 ProteinShop 146
147 RPFM                                                       -0.77 -0.89 -1.18 -0.70 -0.72 -1.00 -0.65 -0.73 -1.10                                                       -1.04 -1.16 -1.43 -1.00 -1.02 -1.32 -1.06 -1.12 -1.50 RPFM 147
148 ShakAbInitio                                                       -0.77 -0.89 -1.18 -0.70 -0.72 -1.00 -0.65 -0.73 -1.10                                                       -1.04 -1.16 -1.43 -1.00 -1.02 -1.32 -1.06 -1.12 -1.50 ShakAbInitio 148
149 TsaiLab                                                       -0.77 -0.89 -1.18 -0.70 -0.72 -1.00 -0.65 -0.73 -1.10                                                       -1.04 -1.16 -1.43 -1.00 -1.02 -1.32 -1.06 -1.12 -1.50 TsaiLab 149
150 UCDavisGenome                                                       -0.77 -0.89 -1.18 -0.70 -0.72 -1.00 -0.65 -0.73 -1.10                                                       -1.04 -1.16 -1.43 -1.00 -1.02 -1.32 -1.06 -1.12 -1.50 UCDavisGenome 150
151 Wolfson−FOBIA                                                       -0.77 -0.89 -1.18 -0.70 -0.72 -1.00 -0.65 -0.73 -1.10                                                       -1.04 -1.16 -1.43 -1.00 -1.02 -1.32 -1.06 -1.12 -1.50 Wolfson−FOBIA 151
152 YASARA                                                       -0.77 -0.89 -1.18 -0.70 -0.72 -1.00 -0.65 -0.73 -1.10                                                       -1.04 -1.16 -1.43 -1.00 -1.02 -1.32 -1.06 -1.12 -1.50 YASARA 152
153 YASARARefine                                                       -0.77 -0.89 -1.18 -0.70 -0.72 -1.00 -0.65 -0.73 -1.10                                                       -1.04 -1.16 -1.43 -1.00 -1.02 -1.32 -1.06 -1.12 -1.50 YASARARefine 153
154 dill_ucsf                                                       -0.77 -0.89 -1.18 -0.70 -0.72 -1.00 -0.65 -0.73 -1.10                                                       -1.04 -1.16 -1.43 -1.00 -1.02 -1.32 -1.06 -1.12 -1.50 dill_ucsf 154
155 dill_ucsf_extended                                                       -0.77 -0.89 -1.18 -0.70 -0.72 -1.00 -0.65 -0.73 -1.10                                                       -1.04 -1.16 -1.43 -1.00 -1.02 -1.32 -1.06 -1.12 -1.50 dill_ucsf_extended 155
156 fais@hgc                                                       -0.77 -0.89 -1.18 -0.70 -0.72 -1.00 -0.65 -0.73 -1.10                                                       -1.04 -1.16 -1.43 -1.00 -1.02 -1.32 -1.06 -1.12 -1.50 fais@hgc 156
157 huber−torda−server                                                       -0.77 -0.89 -1.18 -0.70 -0.72 -1.00 -0.65 -0.73 -1.10                                                       -1.04 -1.16 -1.43 -1.00 -1.02 -1.32 -1.06 -1.12 -1.50 huber−torda−server 157
158 jacobson                                                       -0.77 -0.89 -1.18 -0.70 -0.72 -1.00 -0.65 -0.73 -1.10                                                       -1.04 -1.16 -1.43 -1.00 -1.02 -1.32 -1.06 -1.12 -1.50 jacobson 158
159 mti                                                       -0.77 -0.89 -1.18 -0.70 -0.72 -1.00 -0.65 -0.73 -1.10                                                       -1.04 -1.16 -1.43 -1.00 -1.02 -1.32 -1.06 -1.12 -1.50 mti 159
160 mumssp                                                       -0.77 -0.89 -1.18 -0.70 -0.72 -1.00 -0.65 -0.73 -1.10                                                       -1.04 -1.16 -1.43 -1.00 -1.02 -1.32 -1.06 -1.12 -1.50 mumssp 160
161 ricardo                                                       -0.77 -0.89 -1.18 -0.70 -0.72 -1.00 -0.65 -0.73 -1.10                                                       -1.04 -1.16 -1.43 -1.00 -1.02 -1.32 -1.06 -1.12 -1.50 ricardo 161
162 rivilo                                                       -0.77 -0.89 -1.18 -0.70 -0.72 -1.00 -0.65 -0.73 -1.10                                                       -1.04 -1.16 -1.43 -1.00 -1.02 -1.32 -1.06 -1.12 -1.50 rivilo 162
163 sessions                                                       -0.77 -0.89 -1.18 -0.70 -0.72 -1.00 -0.65 -0.73 -1.10                                                       -1.04 -1.16 -1.43 -1.00 -1.02 -1.32 -1.06 -1.12 -1.50 sessions 163
164 taylor                                                       -0.77 -0.89 -1.18 -0.70 -0.72 -1.00 -0.65 -0.73 -1.10                                                       -1.04 -1.16 -1.43 -1.00 -1.02 -1.32 -1.06 -1.12 -1.50 taylor 164
165 test_http_server_01                                                       -0.77 -0.89 -1.18 -0.70 -0.72 -1.00 -0.65 -0.73 -1.10                                                       -1.04 -1.16 -1.43 -1.00 -1.02 -1.32 -1.06 -1.12 -1.50 test_http_server_01 165
166 tripos_08                                                       -0.77 -0.89 -1.18 -0.70 -0.72 -1.00 -0.65 -0.73 -1.10                                                       -1.04 -1.16 -1.43 -1.00 -1.02 -1.32 -1.06 -1.12 -1.50 tripos_08 166