T0409

Targets
387 388 389 390
391 392 393 394
395 396 397 398
399 400 401 402
403 404 405 406
407 408 409 410
411 412 413 414
415 416 417 418
419 420 421 422
423 424 425 426
427 428 429 430
431 432 433 434
435 436 437 438
439 440 441 442
443 444 445 446
447 448 449 450
451 452 453 454
455 456 457 458
459 460 461 462
463 464 465 466
467 468 469 470
471 472 473 474
475 476 477 478
479 480 481 482
483 484 485 486
487 488 489 490
491 492 493 494
495 496 497 498
499 500 501 502
503 504 505 506
507 508 509 510
511 512 513 514

T0409

residues 318...420 of putative penicillin-binding protein MrcA from Nitrosomonas europaea ATCC 19718

Target type: Human/Server

Target sequence:

>T0409 residues 318...420 mrcA, Nitrosomonas europaea ATCC 19718, 103 residues
YRGPEAFLKLPKDLKDREALQDIMQDIGNSDDILAAVVLSATPGAVEAFRKNGETIRITGDGLKAAHRFLSNDPKIGEKRIRPGALIRVKKTEKGSWQIVQLP

Structure:
Method: X-ray, res=1.64Å, R/Rfree=0.17/0.22
Determined by: MCSG
PDB ID: 3d0f

3d0f_A cartoon
Ribbon diagram of 409: 3d0f chains A (rainbow) and B (white) with swapped N-termini

PyMOL of 3d0f

Domains:  PyMOL of domains

Single domain protein. However, there is a domain swap with another chain, thus a compact domain is different from the entire chain. Its residue range in PDB is B:316-348,A:349-420. Functional relevance of this swap is unclear as this structure is a domain from a larger protein.

409 domain evaluation plot
Correlation between GDT-TS scores for domain-based evlatuation with a swapped domain (y, vertical axis) and whole chain GDT-TS (x, horizontal axis).

409 domain evaluation plot
Correlation between GDT-TS scores for domain-based evlatuation with N-terminal segment removed (just A:349-420, y, vertical axis) and whole chain GDT-TS (x, horizontal axis).

Each point represents first server model. Green, gray and black points are top 10, bottom 25% and the rest of prediction models. Blue line is the best-fit slope line (intersection 0) to the top 10 server models. Red line is the diagonal. Slope and root mean square y-x distance for the top 10 models (average difference between the domain GDT-TS scores and the whole chain GDT-TS score) are shown above the plot.

Structure classification:

OB fold.

3d0f_A:349-420 cartoon
Cartoon diagram of 409: 3d0f chain A residues 349-420

CASP category:

Whole chain: Fold recognition.

Domain (with swap segment removed): Comparative modeling:hard. Domain (swap): Fold recognition.

Closest templates:

OB-fold proteins, e.g. 2je6 chain I.

Conse     5    65 7 9  5   8  7 5               5 5  5                        6  8  5 656             87 5  

2eqs_A  EEPTIGDIYNGKVTSIMQFGCFVQLEG-------LRKRWEGLVHISELRRE----------GRVANVADVVSKGQRVKVKVLSFTG----TKTSLSMKDVD

2pmz_E  YVPVVQEVVEGEVLQVDNYGIFVNLGP-----------MDGLVHISQITDDTLKYDNVRGIIFGEKSKKVIQKGDKVRARVISVASTV--PRIALTMRQPY

2ba0_A  YTPSVGDVVIGIIREVAANGWAVDIYS----------PYQAFLPVSENPEM----------KPNKKPNEVLDIGDAIIAKVLNIDP---KMKVTLTMKDRI

1sro_A  AEIEVGRVYTGKVTRIVDFGAFVAIGG----------GKEGLVHISQIADK-----------RVEKVTDYLQMGQEVPVKVLEVDR---QGRIRLSIKEA-

2aho_B  KLPSEGEILIATVKQVFDYGSYVSLDE--------YGGLQAFLPWSEVS----------------NIRDVLKENRKVIVKVIRVDRR--KGTVDVSLKKVT

3bzc_A  KDLKPGMVLEGVVTNVTNFGAFVDIGV----------HQDGLVHISALSEK-----------FVKDPYEVVKAGDIVKVKVMEVDIP--RNRVGLSMRMSD

1wi5_A  EALKPGMLLTGTVSSLEDHGYLVDIGV---------DGTRAFLPLLKAQEY----------IRQKNKGAKLKVGQYLNCIVEKVKGN--GGVVSLSVGHSE

2cqo_A  NLPALYTIFQGEVAMVTDYGAFIKIPG---------CRKQGLVHRTHMSSC-----------RVDKPSEIVDVGDKVWVKLIGREMKNDRIKVSLSMKVVN

1q46_A  KYPEIDDIVMVNVQQIAEMGAYVKLLE--------YDNIEGMILLSELSRR-----------RIRSIQKLIRVGKNDVAVVLRVDKE--KGYIDLSKRRVS

2ba1_A  PEIVKGDVVLGRVVDLRNSIALIEVSSKKGENRGPSNRGIGILHVSNVDEG-----------YVKEISEAVGYLDILKARVIGD-------NLRLSTKEEE

2je6_I  YYPKINDIVIGLVEDVEIYGWVVDIKA----------PYKAYLPASNLLGRSI--------NVGEDLRRYLDVGDYVIARIENFDR---SIDPVLSVKGKD

T0409   DIGNSDDILAAVVLSATPGAVEAFRKN----------GETIRITGDGLKAAHRFL-----SNDPKIGEKRIRPGALIRVKKTE--------KGSWQIVQLP

Consea  .....splh.t.V.pl...thhlpl.s............p.hl..s.h............c.......c.lp.Gp.l.h+lhphp......ph.lo.....

Conses         eeeeeeeeee  eeeeee              eeeeeee          .     h    hhee    eeeeeeeee       eeeeeee  

Target sequence - PDB file inconsistencies:

T0409    3d0f.pdb    T0409.pdb    PyMOL    PyMOL of domains    

T0409    1 --YRGPEAFLKLPKDLKDREALQDIMQDIGNSDDILAAVVLSATPGAVEAFRKNGETIRITGDGLKAAHRFLSNDPKIGEKRIRPGALIRVKKTEKGSWQIVQLP 103
           ~~|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3d0fA  316 NAYRGPEAFLKLPKDLKDREALQDIMQDIGNSDDILAAVVLSATPGAVEAFRKNGETIRITGDGLKAAHRFLSNDPKIGEKRIRPGALIRVKKTEKGSWQIVQLP 420

Residue change log: change 341, MSE to MET; remove 316-NA-317 as it is not present in target sequence;

Single-domain protein:

1st domain: target 32-103 ; pdb 349-420

Sequence classification:

Membrane carboxypeptidase/penicillin-binding protein (COG5009) in CDD.

Server predictions:

T0409:pdb 318-420:seq 1-103:FR;   alignment

distribution of first scores
First models for T0409: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

409_1:pdb 349-420:seq 32-103:CM_hard;   alignment

distribution of first scores
First models for T0409_1: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

409_1s:pdb B:318-348,A:349-420:seq 1-103:FR;   alignment

distribution of first scores
First models for T0409_1s: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

# GROUP ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ ↓ GROUP #
T0409 409_1 409_1s T0409 409_1 409_1s T0409 409_1 409_1s T0409 409_1 409_1s
First score First Z-score Best score Best Z-score
1 Jiang_Zhu 50.24 46.52 59.99 47.82 43.93 67.63 68.40 63.08 55.33 1.39 1.60 1.08 0.26 0.41 0.97 1.20 1.33 1.05 50.24 46.52 59.99 47.82 43.93 67.63 68.40 63.08 55.33 1.29 1.37 0.82 -0.00 0.12 0.79 1.07 1.13 0.79 Jiang_Zhu 1
2 SAMUDRALA 48.79 45.39 67.44 47.57 44.17 75.20 68.06 63.19 61.85 1.25 1.48 1.66 0.24 0.43 1.52 1.18 1.34 1.67 48.79 45.39 67.44 48.54 44.82 75.20 68.40 63.19 61.85 1.12 1.24 1.48 0.06 0.20 1.46 1.07 1.14 1.47 SAMUDRALA 2
3 SAM−T06−server 48.06 44.01 59.71 65.62 57.06 65.15 65.62 57.06 53.03 1.17 1.33 1.05 1.59 1.45 0.80 1.01 0.90 0.83 48.06 44.01 59.71 65.62 58.33 65.15 65.62 58.33 53.03 1.04 1.08 0.79 1.47 1.34 0.57 0.85 0.75 0.55 SAM−T06−server 3
4 Zhang 47.33 42.31 67.66 51.21 46.04 74.29 67.01 60.07 63.50 1.10 1.14 1.68 0.52 0.58 1.45 1.11 1.11 1.82 47.33 43.12 68.34 52.18 46.84 74.30 67.36 61.34 64.58 0.95 0.97 1.56 0.36 0.37 1.38 0.99 0.99 1.75 Zhang 4
5 MULTICOM 47.09 41.75 66.38 49.76 44.09 72.56 66.32 60.30 62.31 1.08 1.08 1.58 0.41 0.42 1.33 1.06 1.13 1.71 47.09 42.15 66.38 49.76 45.71 73.09 66.32 60.30 62.94 0.93 0.86 1.38 0.16 0.27 1.27 0.91 0.91 1.58 MULTICOM 5
6 PS2−server 46.84 44.26 56.77 66.32 62.85 70.10 66.32 62.85 49.93 1.05 1.35 0.82 1.65 1.90 1.15 1.06 1.31 0.54 46.84 44.26 56.77 66.32 62.85 70.10 66.32 62.85 49.93 0.90 1.11 0.53 1.53 1.72 1.01 0.91 1.11 0.23 PS2−server 6
7 PS2−manual 46.84 44.26 56.77 46.36 43.77 70.43 66.32 62.85 53.08 1.05 1.35 0.82 0.15 0.40 1.18 1.06 1.31 0.84 46.84 44.26 56.77 46.36 43.77 70.43 66.32 62.85 53.08 0.90 1.11 0.53 -0.12 0.11 1.04 0.91 1.11 0.56 PS2−manual 7
8 ABIpro 46.84 41.51 64.76 52.18 44.42 70.33 65.28 55.56 61.51 1.05 1.05 1.45 0.59 0.45 1.17 0.99 0.79 1.63 47.57 41.75 66.76 53.16 44.42 71.37 65.97 57.41 62.61 0.98 0.81 1.42 0.44 0.16 1.12 0.88 0.67 1.55 ABIpro 8
9 METATASSER 46.60 42.88 63.91 67.01 61.69 72.66 67.01 61.69 55.39 1.03 1.20 1.39 1.70 1.81 1.34 1.11 1.23 1.06 46.60 42.88 63.91 67.01 61.69 72.66 67.01 61.69 55.39 0.87 0.94 1.16 1.59 1.62 1.23 0.96 1.02 0.80 METATASSER 9
10 Elofsson 46.36 41.51 49.90 43.45 39.73 62.49 62.15 57.06 47.86 1.00 1.05 0.28 -0.07 0.08 0.60 0.78 0.90 0.34 46.60 43.61 50.26 43.69 40.53 62.49 62.50 58.22 48.03 0.87 1.03 -0.05 -0.34 -0.16 0.34 0.61 0.74 0.03 Elofsson 10
11 Ozkan−Shell 46.12 39.97 67.21 49.27 41.18 73.24 63.89 53.01 62.31 0.98 0.89 1.65 0.37 0.19 1.38 0.90 0.60 1.71 52.43 48.87 68.90 56.31 50.73 75.60 73.26 68.29 64.48 1.54 1.65 1.61 0.70 0.70 1.49 1.46 1.55 1.74 Ozkan−Shell 11
12 Zhang−Server 46.12 39.89 65.34 65.62 57.29 71.59 65.62 57.29 59.57 0.98 0.88 1.50 1.59 1.47 1.26 1.01 0.91 1.45 48.54 43.69 68.24 68.40 61.46 73.34 68.40 61.46 61.74 1.09 1.04 1.55 1.70 1.60 1.29 1.07 1.00 1.45 Zhang−Server 12
13 LevittGroup 45.87 41.67 70.10 52.91 44.50 74.34 64.24 59.14 64.91 0.95 1.07 1.87 0.64 0.46 1.46 0.92 1.05 1.96 45.87 41.75 70.10 52.91 44.50 74.34 64.58 59.14 64.91 0.79 0.81 1.71 0.42 0.17 1.38 0.77 0.81 1.78 LevittGroup 13
14 3DShot1 45.87 39.08 52.05 45.15 38.35 64.14 64.58 54.86 49.85 0.95 0.79 0.45 0.06 -0.03 0.72 0.94 0.74 0.53 45.87 39.08 52.05 45.15 38.35 64.14 64.58 54.86 49.85 0.79 0.50 0.11 -0.22 -0.35 0.48 0.77 0.47 0.22 3DShot1 14
15 FAMS−multi 45.87 39.08 57.41 48.06 41.91 64.04 64.58 56.02 55.82 0.95 0.79 0.87 0.28 0.25 0.72 0.94 0.82 1.10 46.12 41.91 57.41 48.06 41.91 65.55 65.62 58.91 55.82 0.81 0.83 0.59 0.02 -0.05 0.61 0.85 0.80 0.84 FAMS−multi 15
16 TASSER 45.87 37.95 59.91 47.09 43.20 67.75 64.93 59.38 56.77 0.95 0.67 1.07 0.21 0.35 0.98 0.97 1.06 1.19 48.79 44.42 67.77 48.54 45.47 73.19 69.79 63.77 61.70 1.12 1.13 1.51 0.06 0.25 1.28 1.18 1.19 1.45 TASSER 16
17 fams−ace2 45.87 37.62 63.31 48.06 39.48 70.07 65.28 53.47 60.45 0.95 0.63 1.34 0.28 0.06 1.15 0.99 0.64 1.53 45.87 41.99 63.45 48.06 41.99 72.68 66.32 61.46 60.45 0.79 0.84 1.12 0.02 -0.04 1.23 0.91 1.00 1.32 fams−ace2 17
18 Bates_BMM 45.39 41.99 57.24 46.84 39.24 64.89 63.89 59.49 55.71 0.91 1.11 0.86 0.19 0.04 0.78 0.90 1.07 1.09 45.39 41.99 57.40 47.33 40.62 65.00 63.89 59.49 55.95 0.73 0.84 0.59 -0.04 -0.16 0.56 0.72 0.84 0.85 Bates_BMM 18
19 3DShotMQ 45.39 39.56 63.02 47.57 43.04 70.83 64.58 54.17 60.72 0.91 0.84 1.32 0.24 0.34 1.20 0.94 0.69 1.56 45.39 39.56 63.02 47.57 43.04 70.83 64.58 54.17 60.72 0.73 0.55 1.08 -0.02 0.05 1.07 0.77 0.41 1.35 3DShotMQ 19
20 Pcons_multi 45.39 38.27 50.80 63.89 55.32 63.06 63.89 55.32 45.63 0.91 0.70 0.35 1.47 1.31 0.64 0.90 0.77 0.13 45.39 38.27 51.20 63.89 55.32 63.06 63.89 55.32 45.67 0.73 0.40 0.03 1.33 1.08 0.39 0.72 0.50 -0.21 Pcons_multi 20
21 fais@hgc 45.15 40.94 65.20 48.54 44.34 71.62 64.58 58.80 61.44 0.88 0.99 1.49 0.32 0.44 1.26 0.94 1.02 1.63 48.79 44.42 65.45 48.54 45.47 73.19 69.79 63.77 61.44 1.12 1.13 1.30 0.06 0.25 1.28 1.18 1.19 1.42 fais@hgc 21
22 McGuffin 45.15 40.94 65.20 48.54 44.34 71.62 64.58 58.80 61.44 0.88 0.99 1.49 0.32 0.44 1.26 0.94 1.02 1.63 48.54 43.69 68.24 53.88 47.01 73.62 68.40 61.46 64.15 1.09 1.04 1.55 0.50 0.38 1.32 1.07 1.00 1.71 McGuffin 22
23 MULTICOM−RANK 45.15 40.62 50.28 63.54 56.83 62.01 63.54 56.83 45.15 0.88 0.96 0.31 1.44 1.43 0.57 0.87 0.88 0.09 46.84 41.02 57.48 66.67 56.94 70.03 66.67 56.94 50.91 0.90 0.72 0.59 1.56 1.22 1.00 0.94 0.64 0.33 MULTICOM−RANK 23
24 Chicken_George 45.15 36.57 57.29 45.15 36.57 70.25 64.58 52.31 53.48 0.88 0.52 0.86 0.06 -0.17 1.16 0.94 0.55 0.87 46.12 42.48 61.53 46.84 42.80 70.72 65.97 61.23 59.16 0.81 0.90 0.95 -0.08 0.03 1.06 0.88 0.98 1.19 Chicken_George 24
25 pro−sp3−TASSER 44.90 41.83 57.09 63.19 57.06 66.77 63.19 57.06 50.56 0.86 1.09 0.85 1.41 1.45 0.91 0.85 0.90 0.60 48.79 44.42 67.77 69.79 63.77 72.90 69.79 63.77 59.13 1.12 1.13 1.51 1.82 1.79 1.25 1.18 1.19 1.18 pro−sp3−TASSER 25
26 A−TASSER 44.66 40.94 59.15 44.66 41.75 64.31 63.89 58.80 55.84 0.83 0.99 1.01 0.02 0.24 0.73 0.90 1.02 1.10 49.03 46.12 62.92 49.03 44.98 70.46 70.14 64.58 58.40 1.15 1.33 1.08 0.10 0.21 1.04 1.21 1.25 1.11 A−TASSER 26
27 Zico 44.66 40.13 64.97 47.82 43.93 71.22 63.54 58.22 61.25 0.83 0.91 1.47 0.26 0.41 1.23 0.87 0.98 1.61 47.82 42.64 68.25 53.64 47.65 73.27 67.36 60.88 64.26 1.01 0.92 1.55 0.48 0.44 1.29 0.99 0.95 1.72 Zico 27
28 ZicoFullSTP 44.66 40.13 64.97 47.82 43.93 71.22 63.54 58.22 61.25 0.83 0.91 1.47 0.26 0.41 1.23 0.87 0.98 1.61 47.82 42.64 68.25 53.64 47.65 73.27 67.36 60.88 64.26 1.01 0.92 1.55 0.48 0.44 1.29 0.99 0.95 1.72 ZicoFullSTP 28
29 ZicoFullSTPFullData 44.66 40.13 64.97 47.82 43.93 71.22 63.54 58.22 61.25 0.83 0.91 1.47 0.26 0.41 1.23 0.87 0.98 1.61 47.82 42.64 68.25 53.64 47.65 73.27 67.36 60.88 64.26 1.01 0.92 1.55 0.48 0.44 1.29 0.99 0.95 1.72 ZicoFullSTPFullData 29
30 MULTICOM−CMFR 44.42 39.89 53.22 61.81 54.86 63.46 61.81 54.86 47.37 0.81 0.88 0.54 1.31 1.27 0.67 0.75 0.74 0.30 46.36 39.89 53.22 64.93 60.07 64.57 64.93 60.07 47.37 0.84 0.59 0.21 1.41 1.48 0.52 0.80 0.89 -0.04 MULTICOM−CMFR 30
31 Sternberg 44.42 38.75 55.72 43.93 38.51 62.74 62.85 55.32 52.42 0.81 0.76 0.74 -0.03 -0.02 0.62 0.82 0.77 0.77 44.42 39.24 56.63 44.17 38.51 62.78 63.19 56.37 53.23 0.62 0.51 0.52 -0.30 -0.33 0.37 0.66 0.59 0.57 Sternberg 31
32 Phyre_de_novo 44.42 38.75 55.72 62.85 55.32 62.33 62.85 55.32 49.23 0.81 0.76 0.74 1.39 1.31 0.59 0.82 0.77 0.47 45.63 41.10 59.49 64.93 58.45 66.45 64.93 58.45 52.17 0.76 0.73 0.77 1.41 1.35 0.69 0.80 0.76 0.46 Phyre_de_novo 32
33 MULTICOM−REFINE 44.42 35.36 50.09 61.81 56.71 61.79 61.81 56.71 44.48 0.81 0.39 0.30 1.31 1.42 0.55 0.75 0.87 0.02 45.15 41.26 54.29 62.15 56.71 63.17 62.15 56.71 48.13 0.70 0.75 0.31 1.18 1.20 0.40 0.58 0.62 0.04 MULTICOM−REFINE 33
34 MUProt 44.42 35.36 50.09 61.81 56.71 61.79 61.81 56.71 44.48 0.81 0.39 0.30 1.31 1.42 0.55 0.75 0.87 0.02 44.42 40.70 54.29 61.81 56.71 63.17 61.81 56.71 48.13 0.62 0.69 0.31 1.16 1.20 0.40 0.55 0.62 0.04 MUProt 34
35 IBT_LT 44.17 38.51 50.54 44.17 37.30 61.62 62.15 54.05 48.81 0.78 0.73 0.33 -0.01 -0.11 0.54 0.78 0.68 0.43 44.17 38.51 50.54 44.17 37.30 61.62 62.15 54.05 48.81 0.59 0.43 -0.02 -0.30 -0.44 0.26 0.58 0.40 0.11 IBT_LT 35
36 MUSTER 44.17 36.89 53.42 60.42 54.28 62.88 60.42 54.28 47.94 0.78 0.55 0.56 1.21 1.23 0.63 0.66 0.70 0.35 45.63 41.59 54.40 62.85 56.60 62.88 62.85 56.60 48.21 0.76 0.79 0.32 1.24 1.19 0.37 0.63 0.61 0.05 MUSTER 36
37 DBAKER 43.93 39.73 62.57 46.60 42.23 65.90 61.81 55.79 59.23 0.76 0.86 1.28 0.17 0.28 0.85 0.75 0.80 1.42 53.64 49.76 72.00 53.40 48.30 78.95 74.31 69.21 64.99 1.68 1.76 1.88 0.46 0.49 1.78 1.54 1.63 1.79 DBAKER 37
38 COMA−M 43.45 37.14 46.49 61.46 54.98 62.99 61.46 54.98 42.12 0.71 0.58 0.01 1.28 1.28 0.64 0.73 0.75 -0.20 43.45 38.84 50.20 61.46 55.56 62.99 61.46 55.56 44.90 0.51 0.47 -0.05 1.13 1.10 0.38 0.53 0.52 -0.29 COMA−M 38
39 SHORTLE 43.45 34.63 50.19 42.96 37.95 63.08 61.46 54.51 47.82 0.71 0.31 0.30 -0.10 -0.06 0.65 0.73 0.71 0.34 43.45 34.63 50.19 42.96 37.95 63.08 61.46 54.51 47.82 0.51 -0.03 -0.06 -0.40 -0.38 0.39 0.53 0.44 0.01 SHORTLE 39
40 HHpred2 43.20 39.48 47.80 60.07 56.13 58.68 60.07 56.13 43.51 0.69 0.83 0.11 1.18 1.37 0.33 0.63 0.83 -0.07 43.20 39.48 47.80 60.07 56.13 58.68 60.07 56.13 43.51 0.48 0.54 -0.27 1.01 1.15 0.01 0.42 0.57 -0.44 HHpred2 40
41 LEE 43.20 39.16 56.31 46.36 41.99 63.01 60.76 54.74 54.92 0.69 0.80 0.79 0.15 0.26 0.64 0.68 0.73 1.01 43.20 39.16 56.52 47.09 41.99 63.01 60.76 54.74 54.92 0.48 0.51 0.51 -0.06 -0.04 0.39 0.47 0.46 0.75 LEE 41
42 FFASsuboptimal 42.96 37.95 44.94 61.11 53.94 64.24 61.11 53.94 40.31 0.66 0.67 -0.11 1.26 1.20 0.73 0.71 0.67 -0.37 42.96 39.81 44.94 61.11 56.60 64.24 61.11 56.60 40.31 0.45 0.58 -0.52 1.10 1.19 0.49 0.50 0.61 -0.77 FFASsuboptimal 42
43 BAKER−ROBETTA 42.72 39.32 55.19 61.11 56.25 62.28 61.11 56.25 50.80 0.64 0.82 0.70 1.26 1.38 0.59 0.71 0.84 0.62 47.33 44.26 65.39 67.71 62.85 72.22 67.71 62.85 57.69 0.95 1.11 1.30 1.64 1.72 1.19 1.02 1.11 1.03 BAKER−ROBETTA 43
44 SAM−T08−human 42.72 37.86 59.35 42.96 38.11 64.17 60.42 53.70 55.78 0.64 0.66 1.03 -0.10 -0.05 0.72 0.66 0.65 1.09 42.72 37.86 59.48 43.20 38.19 65.11 60.76 54.05 56.02 0.42 0.35 0.77 -0.38 -0.36 0.57 0.47 0.40 0.86 SAM−T08−human 44
45 MULTICOM−CLUSTER 42.72 37.38 50.97 59.03 53.47 61.31 59.03 53.47 45.67 0.64 0.61 0.36 1.10 1.16 0.52 0.56 0.64 0.14 45.15 40.78 50.97 63.54 56.94 62.12 63.54 56.94 45.67 0.70 0.70 0.01 1.30 1.22 0.31 0.69 0.64 -0.21 MULTICOM−CLUSTER 45
46 HHpred5 42.48 37.95 48.68 60.07 53.59 59.83 60.07 53.59 43.89 0.61 0.67 0.18 1.18 1.17 0.41 0.63 0.65 -0.03 42.48 37.95 48.68 60.07 53.59 59.83 60.07 53.59 43.89 0.40 0.36 -0.19 1.01 0.94 0.11 0.42 0.37 -0.40 HHpred5 46
47 RAPTOR 42.48 37.78 45.47 56.94 50.81 57.22 56.94 50.81 40.62 0.61 0.65 -0.07 0.94 0.95 0.22 0.42 0.45 -0.34 42.48 37.78 49.58 59.38 53.12 59.88 59.38 53.12 44.23 0.40 0.34 -0.11 0.96 0.90 0.11 0.36 0.33 -0.36 RAPTOR 47
48 keasar−server 42.48 37.46 50.24 59.38 54.28 60.18 59.38 54.28 45.20 0.61 0.62 0.31 1.13 1.23 0.44 0.59 0.70 0.09 42.48 39.00 52.67 59.38 54.98 63.77 59.38 54.98 47.65 0.40 0.49 0.16 0.96 1.05 0.45 0.36 0.48 -0.01 keasar−server 48
49 fais−server 42.48 36.97 49.33 60.42 52.78 60.21 60.42 52.78 44.38 0.61 0.56 0.24 1.21 1.11 0.44 0.66 0.59 0.01 42.48 37.78 52.88 60.42 54.05 60.21 60.42 54.05 49.18 0.40 0.34 0.18 1.04 0.97 0.14 0.44 0.40 0.15 fais−server 49
50 GeneSilico 42.48 35.36 56.80 46.60 36.73 60.35 60.07 49.88 55.70 0.61 0.39 0.82 0.17 -0.16 0.45 0.63 0.38 1.08 45.87 39.40 63.78 49.52 42.72 69.29 65.28 56.71 61.98 0.79 0.53 1.15 0.14 0.02 0.94 0.83 0.62 1.48 GeneSilico 50
51 Phyre2 42.23 38.51 48.04 60.07 54.51 60.08 60.07 54.51 43.89 0.59 0.73 0.13 1.18 1.25 0.43 0.63 0.71 -0.03 45.87 42.56 62.94 65.28 57.41 71.42 65.28 57.41 54.99 0.79 0.91 1.08 1.44 1.26 1.12 0.83 0.67 0.75 Phyre2 51
52 COMA 42.23 36.57 45.91 60.07 48.96 58.07 60.07 48.96 42.22 0.59 0.52 -0.03 1.18 0.81 0.28 0.63 0.31 -0.19 42.23 39.64 50.20 60.07 54.05 62.99 60.07 54.05 44.90 0.37 0.56 -0.05 1.01 0.97 0.38 0.42 0.40 -0.29 COMA 52
53 EB_AMU_Physics 42.23 36.25 51.16 42.72 35.92 57.55 59.72 52.55 49.43 0.59 0.48 0.38 -0.12 -0.22 0.25 0.61 0.57 0.49 42.23 36.25 51.16 42.72 35.92 57.55 59.72 52.55 49.43 0.37 0.16 0.03 -0.42 -0.55 -0.09 0.39 0.28 0.18 EB_AMU_Physics 53
54 HHpred4 41.75 38.03 45.95 59.03 52.78 56.65 59.03 52.78 41.63 0.54 0.68 -0.03 1.10 1.11 0.18 0.56 0.59 -0.25 41.75 38.03 45.95 59.03 52.78 56.65 59.03 52.78 41.63 0.31 0.37 -0.43 0.93 0.87 -0.17 0.33 0.30 -0.63 HHpred4 54
55 Frankenstein 41.75 32.20 43.26 59.38 45.72 59.24 59.38 45.72 39.02 0.54 0.04 -0.24 1.13 0.55 0.37 0.59 0.08 -0.49 44.90 40.53 50.69 63.54 57.29 61.75 63.54 57.29 45.86 0.67 0.67 -0.01 1.30 1.25 0.27 0.69 0.66 -0.19 Frankenstein 55
56 SMEG−CCP 41.51 37.14 56.26 41.26 36.73 63.57 59.03 52.78 52.97 0.52 0.58 0.78 -0.23 -0.16 0.68 0.56 0.59 0.83 41.51 37.14 56.26 41.26 36.73 63.57 59.03 52.78 52.97 0.28 0.27 0.48 -0.54 -0.48 0.43 0.33 0.30 0.54 SMEG−CCP 56
57 FALCON_CONSENSUS 41.26 38.67 38.29 58.68 54.28 57.85 58.68 54.28 35.29 0.49 0.75 -0.64 1.07 1.23 0.27 0.54 0.70 -0.85 41.26 38.67 53.77 58.68 54.28 58.33 58.68 54.28 48.10 0.26 0.45 0.26 0.90 0.99 -0.03 0.31 0.42 0.04 FALCON_CONSENSUS 57
58 Jones−UCL 41.26 34.30 62.49 43.45 35.84 66.66 56.94 47.45 57.91 0.49 0.27 1.27 -0.07 -0.23 0.90 0.42 0.20 1.29 42.96 39.73 62.49 43.45 38.59 67.96 60.07 55.44 57.91 0.45 0.57 1.04 -0.36 -0.33 0.82 0.42 0.51 1.06 Jones−UCL 58
59 JIVE08 41.02 35.27 48.80 40.29 34.63 58.90 57.99 49.19 47.09 0.47 0.38 0.19 -0.30 -0.32 0.34 0.49 0.33 0.27 41.02 35.27 48.80 40.29 34.63 58.90 57.99 49.19 47.09 0.23 0.05 -0.18 -0.62 -0.66 0.02 0.25 0.01 -0.07 JIVE08 59
60 MidwayFolding 40.78 36.89 49.42 42.72 35.92 55.61 57.29 48.73 47.90 0.44 0.55 0.24 -0.12 -0.22 0.11 0.45 0.30 0.35 40.78 36.89 49.42 42.72 35.92 55.61 57.29 48.73 47.90 0.20 0.24 -0.12 -0.42 -0.55 -0.26 0.20 -0.03 0.02 MidwayFolding 60
61 CBSU 40.78 35.60 41.17 36.16 30.66 45.90 51.74 43.87 41.67 0.44 0.41 -0.41 -0.61 -0.64 -0.59 0.07 -0.05 -0.24 43.45 39.48 55.35 43.93 39.32 60.39 62.50 56.48 51.97 0.51 0.54 0.40 -0.32 -0.27 0.16 0.61 0.60 0.44 CBSU 61
62 GS−KudlatyPred 40.78 33.66 37.38 57.99 48.03 55.56 57.99 48.03 33.94 0.44 0.20 -0.71 1.02 0.73 0.10 0.49 0.25 -0.97 42.23 39.00 40.02 60.42 55.79 57.87 60.42 55.79 36.46 0.37 0.49 -0.96 1.04 1.12 -0.07 0.44 0.54 -1.17 GS−KudlatyPred 62
63 SAM−T08−server 40.53 36.16 58.26 57.64 51.39 64.37 57.64 51.39 51.20 0.42 0.47 0.94 1.00 1.00 0.74 0.47 0.49 0.66 40.53 36.57 58.26 57.64 51.97 64.37 57.64 51.97 51.20 0.17 0.20 0.66 0.81 0.80 0.50 0.22 0.23 0.36 SAM−T08−server 63
64 3D−JIGSAW_AEP 40.29 37.86 51.79 57.64 54.17 58.22 57.64 54.17 46.60 0.40 0.66 0.43 1.00 1.22 0.30 0.47 0.69 0.22 43.45 41.34 55.06 62.15 58.91 61.97 62.15 58.91 49.11 0.51 0.76 0.38 1.18 1.38 0.29 0.58 0.80 0.14 3D−JIGSAW_AEP 64
65 fleil 40.29 36.73 48.42 40.29 36.57 58.69 57.29 52.20 46.68 0.40 0.54 0.16 -0.30 -0.17 0.33 0.45 0.55 0.23 41.51 37.95 50.02 40.53 37.30 59.59 58.33 53.94 47.56 0.28 0.36 -0.07 -0.60 -0.44 0.09 0.28 0.39 -0.02 fleil 65
66 CpHModels 40.05 35.36 39.37 56.25 50.69 58.72 56.25 50.69 35.42 0.37 0.39 -0.55 0.89 0.94 0.33 0.37 0.44 -0.83 40.05 35.36 39.37 56.25 50.69 58.72 56.25 50.69 35.42 0.12 0.06 -1.02 0.70 0.69 0.01 0.11 0.13 -1.28 CpHModels 66
67 Hao_Kihara 40.05 33.66 40.87 38.84 33.98 60.80 55.56 47.92 40.93 0.37 0.20 -0.43 -0.41 -0.37 0.48 0.33 0.24 -0.31 43.20 37.22 47.20 42.96 37.95 62.06 60.76 53.59 45.79 0.48 0.28 -0.32 -0.40 -0.38 0.30 0.47 0.37 -0.20 Hao_Kihara 67
68 Pcons_dot_net 39.08 37.78 32.86 55.90 54.05 51.85 55.90 54.05 30.81 0.27 0.65 -1.06 0.87 1.21 -0.16 0.35 0.68 -1.27 47.33 44.26 65.39 67.71 62.85 72.22 67.71 62.85 57.69 0.95 1.11 1.30 1.64 1.72 1.19 1.02 1.11 1.03 Pcons_dot_net 68
69 FALCON 39.08 31.47 44.07 53.82 45.49 53.90 53.82 45.49 39.36 0.27 -0.03 -0.18 0.71 0.53 -0.02 0.21 0.06 -0.46 39.08 37.54 53.77 54.51 52.66 58.33 54.51 52.66 48.10 0.00 0.31 0.26 0.55 0.86 -0.03 -0.02 0.29 0.04 FALCON 69
70 GS−MetaServer2 38.84 36.41 33.53 55.56 51.74 52.27 55.56 51.74 31.29 0.25 0.50 -1.01 0.84 1.03 -0.13 0.33 0.51 -1.22 38.84 36.41 43.13 55.56 51.74 55.33 55.56 51.74 39.08 -0.02 0.18 -0.68 0.64 0.78 -0.29 0.06 0.22 -0.90 GS−MetaServer2 70
71 GeneSilicoMetaServer 38.84 36.41 33.53 55.56 51.74 52.27 55.56 51.74 31.29 0.25 0.50 -1.01 0.84 1.03 -0.13 0.33 0.51 -1.22 38.84 36.41 43.13 55.56 51.74 55.33 55.56 51.74 39.08 -0.02 0.18 -0.68 0.64 0.78 -0.29 0.06 0.22 -0.90 GeneSilicoMetaServer 71
72 3D−JIGSAW_V3 38.35 31.39 50.45 54.86 44.91 56.67 54.86 44.91 44.85 0.20 -0.04 0.32 0.79 0.49 0.18 0.28 0.02 0.06 38.35 33.49 50.45 54.86 49.54 56.96 54.86 49.54 44.85 -0.08 -0.16 -0.03 0.58 0.59 -0.15 0.01 0.04 -0.30 3D−JIGSAW_V3 72
73 Pcons_local 37.38 35.11 32.99 53.47 50.23 51.67 53.47 50.23 30.58 0.10 0.36 -1.05 0.68 0.91 -0.18 0.19 0.40 -1.29 44.42 39.24 46.87 61.81 58.56 61.25 61.81 58.56 42.19 0.62 0.51 -0.35 1.16 1.36 0.23 0.55 0.77 -0.57 Pcons_local 73
74 FFASstandard 37.38 34.47 32.41 53.47 49.07 50.04 53.47 49.07 30.29 0.10 0.29 -1.10 0.68 0.82 -0.29 0.19 0.32 -1.32 37.86 34.47 32.41 53.47 49.07 50.12 53.47 49.07 30.29 -0.14 -0.05 -1.64 0.47 0.56 -0.75 -0.10 -0.00 -1.81 FFASstandard 74
75 FFASflextemplate 37.38 34.47 32.41 53.47 49.07 50.04 53.47 49.07 30.29 0.10 0.29 -1.10 0.68 0.82 -0.29 0.19 0.32 -1.32 37.86 34.47 32.41 53.47 49.07 50.12 53.47 49.07 30.29 -0.14 -0.05 -1.64 0.47 0.56 -0.75 -0.10 -0.00 -1.81 FFASflextemplate 75
76 3DShot2 37.14 26.21 40.15 52.78 40.86 49.31 52.78 40.86 36.89 0.08 -0.61 -0.49 0.63 0.17 -0.35 0.14 -0.27 -0.70 37.14 26.21 40.15 52.78 40.86 49.31 52.78 40.86 36.89 -0.22 -1.02 -0.95 0.41 -0.14 -0.82 -0.16 -0.66 -1.12 3DShot2 76
77 POEMQA 36.41 32.85 52.99 40.05 32.69 57.60 51.39 46.30 52.56 0.01 0.12 0.52 -0.32 -0.48 0.25 0.04 0.12 0.79 36.41 32.85 52.99 40.05 32.69 57.60 51.39 46.30 52.56 -0.30 -0.24 0.19 -0.64 -0.83 -0.09 -0.27 -0.22 0.50 POEMQA 77
78 AMU−Biology 35.68 30.50 50.19 37.86 25.73 53.20 49.31 41.90 48.76 -0.07 -0.14 0.30 -0.48 -1.02 -0.07 -0.10 -0.20 0.43 35.68 30.50 50.19 37.86 28.56 53.20 49.31 41.90 48.76 -0.39 -0.52 -0.06 -0.82 -1.17 -0.48 -0.43 -0.58 0.11 AMU−Biology 78
79 PSI 32.28 26.46 53.49 45.49 36.92 56.93 45.49 36.92 47.40 -0.41 -0.58 0.56 0.09 -0.14 0.20 -0.36 -0.56 0.30 33.74 27.35 53.49 45.83 39.35 56.93 45.83 39.35 47.40 -0.61 -0.89 0.24 -0.17 -0.26 -0.15 -0.71 -0.79 -0.03 PSI 79
80 BioSerf 31.55 23.14 49.86 43.06 36.11 52.54 43.06 36.11 44.25 -0.48 -0.94 0.28 -0.09 -0.21 -0.11 -0.52 -0.61 0.00 31.55 23.14 49.86 43.06 36.11 52.54 43.06 36.11 44.25 -0.86 -1.38 -0.08 -0.39 -0.54 -0.53 -0.93 -1.05 -0.36 BioSerf 80
81 POEM 31.07 26.46 52.11 34.47 29.37 52.80 41.67 34.84 51.15 -0.53 -0.58 0.45 -0.74 -0.74 -0.10 -0.62 -0.71 0.65 31.07 26.46 52.99 34.47 29.37 57.60 42.36 35.65 52.56 -0.92 -0.99 0.19 -1.11 -1.11 -0.09 -0.98 -1.09 0.50 POEM 81
82 MUFOLD−MD 30.10 27.35 47.47 43.06 39.12 51.60 43.06 39.12 45.67 -0.63 -0.48 0.09 -0.09 0.03 -0.18 -0.52 -0.40 0.14 31.55 27.83 52.47 43.75 39.12 53.74 43.75 39.12 48.22 -0.86 -0.83 0.15 -0.34 -0.28 -0.43 -0.87 -0.80 0.05 MUFOLD−MD 82
83 TJ_Jiang 29.85 24.19 52.10 34.22 24.35 54.70 40.97 32.64 52.08 -0.65 -0.82 0.45 -0.76 -1.13 0.04 -0.67 -0.86 0.74 33.25 27.43 52.10 34.95 29.61 54.70 47.57 39.24 52.08 -0.67 -0.88 0.11 -1.07 -1.08 -0.34 -0.57 -0.80 0.45 TJ_Jiang 83
84 Bilab−UT 28.64 24.11 47.09 27.18 23.79 47.57 37.15 33.22 45.85 -0.77 -0.83 0.06 -1.28 -1.18 -0.47 -0.93 -0.82 0.15 28.64 24.11 47.09 33.01 27.35 47.87 37.15 33.22 45.85 -1.20 -1.27 -0.33 -1.23 -1.28 -0.94 -1.39 -1.28 -0.19 Bilab−UT 84
85 ShakAbInitio 27.91 22.73 38.86 26.46 22.57 43.07 37.15 31.83 39.72 -0.84 -0.98 -0.59 -1.34 -1.27 -0.80 -0.93 -0.92 -0.43 33.49 27.35 42.77 31.55 25.57 45.93 40.97 35.42 43.79 -0.64 -0.89 -0.71 -1.35 -1.43 -1.11 -1.09 -1.10 -0.41 ShakAbInitio 85
86 Handl−Lovell 27.18 24.59 40.41 35.92 30.26 44.47 38.19 34.49 44.20 -0.92 -0.78 -0.47 -0.63 -0.67 -0.70 -0.86 -0.73 -0.00 27.18 24.68 47.28 35.92 30.26 50.86 38.19 34.49 46.79 -1.37 -1.20 -0.31 -0.99 -1.03 -0.68 -1.31 -1.18 -0.10 Handl−Lovell 86
87 Sasaki−Cetin−Sasai 26.94 25.16 49.97 27.18 25.41 52.83 38.54 35.99 47.96 -0.94 -0.72 0.29 -1.28 -1.05 -0.09 -0.83 -0.62 0.35 33.01 28.48 52.71 33.25 28.07 55.53 45.49 39.01 49.90 -0.69 -0.75 0.17 -1.21 -1.21 -0.27 -0.73 -0.81 0.23 Sasaki−Cetin−Sasai 87
88 Poing 26.70 20.71 33.61 36.11 27.55 36.49 36.11 27.55 31.71 -0.97 -1.20 -1.01 -0.62 -0.88 -1.27 -1.00 -1.23 -1.19 26.70 20.71 35.51 36.11 28.93 38.19 36.11 28.93 32.03 -1.42 -1.67 -1.36 -0.97 -1.14 -1.79 -1.47 -1.63 -1.63 Poing 88
89 keasar 25.73 23.62 46.24 30.82 25.48 50.84 36.81 33.80 46.36 -1.06 -0.89 -0.01 -1.01 -1.04 -0.24 -0.95 -0.78 0.20 47.09 44.01 65.89 49.03 40.45 71.68 65.97 61.81 61.75 0.93 1.08 1.34 0.10 -0.17 1.15 0.88 1.03 1.46 keasar 89
90 Phragment 25.48 23.87 39.41 36.46 34.14 43.56 36.46 34.14 35.96 -1.09 -0.86 -0.55 -0.59 -0.36 -0.76 -0.97 -0.76 -0.78 26.21 23.87 40.00 36.46 34.14 43.56 36.46 34.14 36.51 -1.48 -1.30 -0.96 -0.94 -0.70 -1.32 -1.45 -1.21 -1.16 Phragment 90
91 ACOMPMOD 25.00 20.31 35.57 35.07 28.59 41.94 35.07 28.59 35.54 -1.14 -1.25 -0.85 -0.69 -0.80 -0.88 -1.07 -1.16 -0.82 25.00 20.31 35.57 35.07 28.59 41.94 35.07 28.59 35.54 -1.62 -1.72 -1.35 -1.06 -1.17 -1.46 -1.55 -1.66 -1.26 ACOMPMOD 91
92 ProteinShop 24.76 21.52 31.41 22.57 20.15 37.73 33.33 29.40 33.91 -1.16 -1.11 -1.18 -1.63 -1.46 -1.18 -1.19 -1.10 -0.98 27.91 24.84 37.44 27.43 24.19 43.26 38.54 34.14 39.49 -1.28 -1.18 -1.19 -1.69 -1.54 -1.35 -1.28 -1.21 -0.85 ProteinShop 92
93 mGenTHREADER 23.30 19.74 30.05 31.94 26.85 38.12 31.94 26.85 29.14 -1.31 -1.31 -1.29 -0.93 -0.94 -1.15 -1.28 -1.28 -1.43 23.30 19.74 30.05 31.94 26.85 38.12 31.94 26.85 29.14 -1.81 -1.79 -1.84 -1.31 -1.32 -1.80 -1.80 -1.80 -1.93 mGenTHREADER 93
94 PRI−Yang−KiharA 23.06 19.18 33.09 28.40 22.57 34.80 28.12 21.88 36.92 -1.33 -1.37 -1.05 -1.19 -1.27 -1.39 -1.54 -1.64 -0.69 30.58 28.24 53.54 38.11 31.80 57.82 44.44 40.97 54.04 -0.97 -0.78 0.24 -0.80 -0.90 -0.07 -0.82 -0.66 0.66 PRI−Yang−KiharA 94
95 RBO−Proteus 22.82 20.71 40.27 31.94 28.93 43.68 31.94 28.93 38.45 -1.35 -1.20 -0.48 -0.93 -0.77 -0.75 -1.28 -1.13 -0.55 35.68 31.47 52.46 51.04 45.02 56.72 51.04 45.02 48.81 -0.39 -0.40 0.15 0.27 0.21 -0.17 -0.30 -0.33 0.11 RBO−Proteus 95
96 FEIG 22.57 19.18 30.96 29.86 25.00 32.71 29.86 25.00 31.21 -1.38 -1.37 -1.21 -1.08 -1.08 -1.54 -1.42 -1.42 -1.23 29.61 25.73 46.53 41.32 35.30 48.14 41.32 35.30 44.77 -1.09 -1.08 -0.38 -0.54 -0.61 -0.92 -1.06 -1.11 -0.31 FEIG 96
97 nFOLD3 22.57 18.04 32.63 30.21 23.73 34.68 30.21 23.73 33.67 -1.38 -1.49 -1.08 -1.06 -1.18 -1.40 -1.40 -1.51 -1.00 40.53 37.38 36.76 57.99 53.47 55.89 57.99 53.47 33.83 0.17 0.30 -1.25 0.84 0.93 -0.24 0.25 0.36 -1.44 nFOLD3 97
98 circle 22.09 18.04 30.48 29.17 24.07 31.99 29.17 24.07 31.47 -1.43 -1.49 -1.25 -1.14 -1.15 -1.60 -1.47 -1.48 -1.21 22.57 19.26 32.40 29.86 24.65 35.05 29.86 24.65 32.41 -1.90 -1.84 -1.64 -1.49 -1.50 -2.07 -1.97 -1.97 -1.59 circle 98
99 taylor 21.84 18.29 24.06 23.54 18.20 28.46 28.82 23.73 30.29 -1.45 -1.46 -1.76 -1.56 -1.62 -1.85 -1.49 -1.51 -1.32 21.84 19.50 39.15 28.64 24.76 42.79 29.86 26.85 40.73 -1.98 -1.81 -1.04 -1.59 -1.49 -1.39 -1.97 -1.80 -0.73 taylor 99
100 FAMSD 21.84 17.96 30.79 29.51 24.65 32.18 29.51 24.65 31.41 -1.45 -1.50 -1.23 -1.11 -1.11 -1.58 -1.45 -1.44 -1.21 23.79 20.71 34.38 32.99 28.24 40.66 32.99 28.24 33.51 -1.76 -1.67 -1.46 -1.23 -1.20 -1.58 -1.72 -1.68 -1.48 FAMSD 100
101 dill_ucsf 21.36 18.29 32.11 21.36 18.61 35.53 29.51 24.88 34.58 -1.50 -1.46 -1.12 -1.72 -1.59 -1.34 -1.45 -1.42 -0.91 23.30 21.12 33.34 24.27 21.04 37.31 33.33 28.82 37.00 -1.81 -1.62 -1.55 -1.95 -1.81 -1.87 -1.69 -1.64 -1.11 dill_ucsf 101
102 LOOPP_Server 20.63 18.04 8.34 29.17 25.46 23.60 29.17 25.46 10.40 -1.57 -1.49 -3.00 -1.14 -1.05 -2.20 -1.47 -1.38 -3.20 31.55 28.96 27.30 45.14 41.44 46.94 45.14 41.44 26.32 -0.86 -0.70 -2.09 -0.22 -0.09 -1.03 -0.76 -0.62 -2.22 LOOPP_Server 102
103 FLOUDAS 20.63 17.96 31.48 19.18 16.83 33.05 25.35 21.18 34.73 -1.57 -1.50 -1.17 -1.88 -1.73 -1.52 -1.73 -1.69 -0.90 33.49 23.79 38.85 34.47 24.76 46.04 47.22 33.33 41.00 -0.64 -1.31 -1.06 -1.11 -1.49 -1.10 -0.60 -1.27 -0.70 FLOUDAS 103
104 pipe_int 20.39 18.20 26.07 26.74 20.72 28.13 26.74 20.72 25.22 -1.60 -1.47 -1.60 -1.32 -1.42 -1.87 -1.64 -1.72 -1.80 20.39 18.20 26.07 26.74 20.72 28.13 26.74 20.72 25.22 -2.15 -1.97 -2.20 -1.74 -1.83 -2.68 -2.21 -2.29 -2.34 pipe_int 104
105 MeilerLabRene 20.39 17.64 36.85 24.03 20.15 40.03 29.17 25.23 40.03 -1.60 -1.53 -0.75 -1.52 -1.46 -1.02 -1.47 -1.40 -0.40 25.48 19.90 38.95 25.97 23.30 43.07 36.11 27.66 40.79 -1.56 -1.77 -1.05 -1.81 -1.62 -1.36 -1.47 -1.73 -0.72 MeilerLabRene 105
106 3Dpro 20.15 17.23 22.04 23.96 19.56 24.89 23.96 19.56 22.93 -1.62 -1.58 -1.92 -1.53 -1.51 -2.11 -1.83 -1.81 -2.02 21.12 19.98 32.58 29.86 27.55 33.14 29.86 27.55 32.00 -2.06 -1.76 -1.62 -1.49 -1.26 -2.24 -1.97 -1.74 -1.63 3Dpro 106
107 MUFOLD−Server 19.66 17.64 34.03 26.74 24.65 38.34 26.74 24.65 32.96 -1.67 -1.53 -0.97 -1.32 -1.11 -1.14 -1.64 -1.44 -1.07 21.60 19.58 36.11 30.21 27.66 40.39 30.21 27.66 34.36 -2.01 -1.80 -1.31 -1.46 -1.25 -1.60 -1.94 -1.73 -1.39 MUFOLD−Server 107
108 igor 19.66 15.78 28.99 19.66 17.07 32.11 27.08 22.92 32.71 -1.67 -1.74 -1.37 -1.85 -1.71 -1.59 -1.61 -1.57 -1.09 19.66 15.78 28.99 19.66 17.07 32.11 27.08 22.92 32.71 -2.23 -2.25 -1.94 -2.33 -2.14 -2.33 -2.18 -2.11 -1.56 igor 108
109 Softberry 19.42 18.45 26.86 25.00 20.47 28.69 25.35 22.68 31.48 -1.70 -1.45 -1.54 -1.45 -1.44 -1.83 -1.73 -1.58 -1.21 19.42 18.45 26.86 25.00 20.47 28.69 25.35 22.68 31.48 -2.26 -1.94 -2.13 -1.89 -1.86 -2.63 -2.32 -2.13 -1.69 Softberry 109
110 Distill 19.42 14.89 36.22 26.74 19.79 38.03 26.74 19.79 34.08 -1.70 -1.83 -0.80 -1.32 -1.49 -1.16 -1.64 -1.79 -0.96 24.76 19.50 41.27 34.38 26.85 43.86 34.38 26.85 38.58 -1.64 -1.81 -0.85 -1.11 -1.32 -1.30 -1.61 -1.80 -0.95 Distill 110
111 mahmood−torda−server 19.18 17.23 19.27 19.44 16.43 21.39 19.44 16.43 20.09 -1.72 -1.58 -2.14 -1.86 -1.76 -2.36 -2.13 -2.03 -2.28 19.18 17.23 24.91 23.26 18.40 28.45 23.26 18.40 24.33 -2.29 -2.08 -2.30 -2.03 -2.03 -2.65 -2.49 -2.48 -2.43 mahmood−torda−server 111
112 forecast 19.18 14.97 27.69 26.04 20.02 27.81 26.04 20.02 27.12 -1.72 -1.82 -1.47 -1.37 -1.47 -1.90 -1.68 -1.77 -1.62 40.53 36.33 52.60 54.86 47.69 61.63 54.86 47.69 47.39 0.17 0.17 0.16 0.58 0.44 0.26 0.01 -0.11 -0.03 forecast 112
113 FOLDpro 18.45 15.13 19.78 20.83 16.09 27.48 20.83 16.09 20.16 -1.79 -1.81 -2.10 -1.76 -1.78 -1.92 -2.04 -2.06 -2.28 21.84 19.58 23.12 29.51 23.26 31.24 29.51 23.26 22.87 -1.98 -1.80 -2.46 -1.52 -1.62 -2.40 -1.99 -2.09 -2.58 FOLDpro 113
114 Scheraga 18.45 14.40 30.76 21.36 19.09 36.78 25.69 19.44 33.07 -1.79 -1.89 -1.23 -1.72 -1.55 -1.25 -1.71 -1.82 -1.06 21.12 19.09 30.81 24.27 20.23 36.78 27.43 24.42 34.09 -2.06 -1.86 -1.78 -1.95 -1.88 -1.92 -2.16 -1.99 -1.41 Scheraga 114
115 OLGAFS 17.96 15.53 16.25 23.61 18.98 18.51 23.61 18.98 17.18 -1.84 -1.76 -2.38 -1.55 -1.56 -2.57 -1.85 -1.85 -2.56 17.96 16.18 19.85 23.61 18.98 26.03 23.61 18.98 20.78 -2.43 -2.21 -2.75 -2.00 -1.98 -2.86 -2.46 -2.43 -2.80 OLGAFS 115
116 StruPPi 17.72 17.23 24.31 19.90 17.31 27.83 22.57 19.68 29.61 -1.87 -1.58 -1.74 -1.83 -1.69 -1.90 -1.92 -1.80 -1.38 17.72 17.23 24.31 19.90 17.31 27.83 22.57 19.68 29.61 -2.45 -2.08 -2.35 -2.31 -2.12 -2.70 -2.54 -2.38 -1.88 StruPPi 116
117 schenk−torda−server 17.48 13.92 22.60 23.61 20.02 26.07 23.61 20.02 22.70 -1.89 -1.94 -1.87 -1.55 -1.47 -2.02 -1.85 -1.77 -2.04 18.45 16.50 25.98 25.69 22.80 28.78 25.69 22.80 26.05 -2.37 -2.17 -2.21 -1.83 -1.66 -2.62 -2.29 -2.12 -2.25 schenk−torda−server 117
118 DistillSN 17.23 14.00 22.32 18.69 16.75 25.25 23.96 18.87 28.22 -1.91 -1.93 -1.90 -1.92 -1.73 -2.08 -1.83 -1.86 -1.52 25.97 21.28 38.45 26.21 22.01 42.76 35.07 29.05 39.21 -1.50 -1.60 -1.10 -1.79 -1.73 -1.39 -1.55 -1.62 -0.88 DistillSN 118
119 xianmingpan 16.99 15.45 21.40 17.48 14.56 23.18 19.44 16.20 26.97 -1.94 -1.77 -1.97 -2.01 -1.91 -2.23 -2.13 -2.05 -1.63 36.16 30.66 44.02 37.14 30.50 51.80 50.69 43.52 43.90 -0.33 -0.50 -0.60 -0.88 -1.01 -0.60 -0.32 -0.45 -0.40 xianmingpan 119
120 mariner1 16.99 13.19 21.24 23.61 19.44 26.91 23.61 19.44 25.13 -1.94 -2.02 -1.98 -1.55 -1.52 -1.96 -1.85 -1.82 -1.81 37.38 33.98 35.14 51.74 48.03 51.40 51.74 48.03 34.27 -0.19 -0.11 -1.39 0.32 0.47 -0.63 -0.24 -0.08 -1.40 mariner1 120
121 huber−torda−server 16.75 14.72 15.72 22.22 18.63 17.32 22.22 18.63 17.33 -1.96 -1.85 -2.42 -1.66 -1.58 -2.65 -1.94 -1.87 -2.55 38.11 37.30 43.74 53.47 52.31 54.30 53.47 52.31 39.13 -0.11 0.29 -0.63 0.47 0.83 -0.38 -0.10 0.26 -0.89 huber−torda−server 121
122 psiphifoldings 16.75 14.40 22.66 15.05 13.51 26.47 20.49 18.98 27.05 -1.96 -1.89 -1.87 -2.19 -1.99 -1.99 -2.06 -1.85 -1.63 16.75 14.40 22.66 15.05 13.51 26.47 20.49 18.98 27.05 -2.57 -2.42 -2.50 -2.71 -2.44 -2.82 -2.70 -2.43 -2.15 psiphifoldings 122
123 panther_server 16.50 15.53 12.40 19.44 16.67 17.53 19.44 16.67 14.02 -1.99 -1.76 -2.68 -1.86 -1.74 -2.64 -2.13 -2.02 -2.86 16.50 15.53 12.40 19.44 16.67 17.53 19.44 16.67 14.02 -2.59 -2.28 -3.41 -2.35 -2.18 -3.61 -2.79 -2.62 -3.50 panther_server 123
124 ProtAnG 16.26 13.51 16.39 16.99 14.40 24.10 23.96 22.45 22.74 -2.01 -1.98 -2.36 -2.05 -1.92 -2.17 -1.83 -1.60 -2.03 16.26 13.51 16.39 16.99 14.40 24.10 23.96 22.45 22.74 -2.62 -2.52 -3.06 -2.55 -2.37 -3.03 -2.43 -2.15 -2.59 ProtAnG 124
125 RANDOM 15.87 13.63 15.87 23.18 19.13 23.18 18.02 15.43 18.02 -2.05 -1.97 -2.41 -1.58 -1.54 -2.23 -2.23 -2.11 -2.48 15.87 13.63 15.87 23.18 19.13 23.18 18.02 15.43 18.02 -2.67 -2.51 -3.10 -2.04 -1.97 -3.11 -2.90 -2.72 -3.08 RANDOM 125
126 Pushchino 15.78 14.81 17.26 21.53 18.52 21.73 21.53 18.52 18.24 -2.06 -1.84 -2.30 -1.71 -1.59 -2.34 -1.99 -1.88 -2.46 15.78 14.81 17.26 21.53 18.52 21.73 21.53 18.52 18.24 -2.68 -2.37 -2.98 -2.18 -2.02 -3.24 -2.62 -2.47 -3.06 Pushchino 126
127 DelCLab 15.29 14.64 24.81 18.20 14.48 27.83 18.40 16.09 29.57 -2.11 -1.86 -1.70 -1.96 -1.91 -1.90 -2.20 -2.06 -1.39 17.48 15.78 25.00 20.15 17.07 28.90 21.18 19.21 29.57 -2.48 -2.25 -2.29 -2.29 -2.14 -2.61 -2.65 -2.41 -1.88 DelCLab 127
128 rehtnap 14.56 13.75 -9.04 0.00 0.00 -5.71 0.00 0.00 -2.96 -2.18 -1.96 -4.37 -3.32 -3.05 -4.32 -3.46 -3.22 -4.47 15.05 13.75 -9.02 0.00 0.00 -5.71 0.00 0.00 -2.96 -2.76 -2.49 -5.32 -3.96 -3.58 -5.65 -4.32 -3.97 -5.26 rehtnap 128
129 HCA 14.56 11.97 8.49 17.23 13.84 16.45 20.83 17.13 17.61 -2.18 -2.15 -2.99 -2.03 -1.96 -2.72 -2.04 -1.98 -2.52 14.56 11.97 8.49 17.23 13.84 16.45 20.83 17.13 17.61 -2.82 -2.70 -3.76 -2.53 -2.41 -3.70 -2.68 -2.58 -3.13 HCA 129
130 Kolinski 14.32 12.38 22.63 14.81 12.95 28.34 20.49 17.71 26.74 -2.21 -2.11 -1.87 -2.21 -2.03 -1.86 -2.06 -1.94 -1.66 29.37 26.29 41.09 29.61 27.51 49.40 42.01 37.62 41.32 -1.11 -1.01 -0.86 -1.51 -1.26 -0.81 -1.01 -0.93 -0.66 Kolinski 130
131 TWPPLAB 13.11 11.16 19.36 16.26 13.35 24.46 18.75 16.32 24.93 -2.33 -2.24 -2.13 -2.10 -2.00 -2.14 -2.18 -2.04 -1.83 13.11 11.16 19.36 16.26 13.35 24.46 18.75 16.32 24.93 -2.98 -2.80 -2.79 -2.61 -2.46 -3.00 -2.84 -2.65 -2.37 TWPPLAB 131
132 Abagyan                                                       -2.05 -1.97 -2.41 -1.58 -1.54 -2.23 -2.23 -2.11 -2.48                                                       -2.67 -2.51 -3.10 -2.04 -1.97 -3.11 -2.90 -2.72 -3.08 Abagyan 132
133 BHAGEERATH                                                       -2.05 -1.97 -2.41 -1.58 -1.54 -2.23 -2.23 -2.11 -2.48                                                       -2.67 -2.51 -3.10 -2.04 -1.97 -3.11 -2.90 -2.72 -3.08 BHAGEERATH 133
134 FEIG_REFINE                                                       -2.05 -1.97 -2.41 -1.58 -1.54 -2.23 -2.23 -2.11 -2.48                                                       -2.67 -2.51 -3.10 -2.04 -1.97 -3.11 -2.90 -2.72 -3.08 FEIG_REFINE 134
135 FUGUE_KM                                                       -2.05 -1.97 -2.41 -1.58 -1.54 -2.23 -2.23 -2.11 -2.48                                                       -2.12 -2.01 -3.10 -1.97 -1.83 -3.11 -2.43 -2.29 -3.08 FUGUE_KM 135
136 Fiser−M4T                                                       -2.05 -1.97 -2.41 -1.58 -1.54 -2.23 -2.23 -2.11 -2.48                                                       -2.67 -2.51 -3.10 -2.04 -1.97 -3.11 -2.90 -2.72 -3.08 Fiser−M4T 136
137 FrankensteinLong                                                       -2.05 -1.97 -2.41 -1.58 -1.54 -2.23 -2.23 -2.11 -2.48                                                       -2.67 -2.51 -3.10 -2.04 -1.97 -3.11 -2.90 -2.72 -3.08 FrankensteinLong 137
138 KudlatyPredHuman                                                       -2.05 -1.97 -2.41 -1.58 -1.54 -2.23 -2.23 -2.11 -2.48                                                       -2.67 -2.51 -3.10 -2.04 -1.97 -3.11 -2.90 -2.72 -3.08 KudlatyPredHuman 138
139 LEE−SERVER                                                       -2.05 -1.97 -2.41 -1.58 -1.54 -2.23 -2.23 -2.11 -2.48                                                       -2.67 -2.51 -3.10 -2.04 -1.97 -3.11 -2.90 -2.72 -3.08 LEE−SERVER 139
140 Linnolt−UH−CMB                                                       -2.05 -1.97 -2.41 -1.58 -1.54 -2.23 -2.23 -2.11 -2.48                                                       -2.67 -2.51 -3.10 -2.04 -1.97 -3.11 -2.90 -2.72 -3.08 Linnolt−UH−CMB 140
141 NIM2                                                       -2.05 -1.97 -2.41 -1.58 -1.54 -2.23 -2.23 -2.11 -2.48                                                       -2.67 -2.51 -3.10 -2.04 -1.97 -3.11 -2.90 -2.72 -3.08 NIM2 141
142 Nano_team                                                       -2.05 -1.97 -2.41 -1.58 -1.54 -2.23 -2.23 -2.11 -2.48                                                       -2.67 -2.51 -3.10 -2.04 -1.97 -3.11 -2.90 -2.72 -3.08 Nano_team 142
143 NirBenTal                                                       -2.05 -1.97 -2.41 -1.58 -1.54 -2.23 -2.23 -2.11 -2.48                                                       -2.67 -2.51 -3.10 -2.04 -1.97 -3.11 -2.90 -2.72 -3.08 NirBenTal 143
144 PHAISTOS                                                       -2.05 -1.97 -2.41 -1.58 -1.54 -2.23 -2.23 -2.11 -2.48                                                       -2.67 -2.51 -3.10 -2.04 -1.97 -3.11 -2.90 -2.72 -3.08 PHAISTOS 144
145 POISE                                                       -2.05 -1.97 -2.41 -1.58 -1.54 -2.23 -2.23 -2.11 -2.48                                                       -2.67 -2.51 -3.10 -2.04 -1.97 -3.11 -2.90 -2.72 -3.08 POISE 145
146 PZ−UAM                                                       -2.05 -1.97 -2.41 -1.58 -1.54 -2.23 -2.23 -2.11 -2.48                                                       -2.67 -2.51 -3.10 -2.04 -1.97 -3.11 -2.90 -2.72 -3.08 PZ−UAM 146
147 RPFM                                                       -2.05 -1.97 -2.41 -1.58 -1.54 -2.23 -2.23 -2.11 -2.48                                                       -2.67 -2.51 -3.10 -2.04 -1.97 -3.11 -2.90 -2.72 -3.08 RPFM 147
148 SAINT1                                                       -2.05 -1.97 -2.41 -1.58 -1.54 -2.23 -2.23 -2.11 -2.48                                                       -2.67 -2.51 -3.10 -2.04 -1.97 -3.11 -2.90 -2.72 -3.08 SAINT1 148
149 SAM−T02−server                                                       -2.05 -1.97 -2.41 -1.58 -1.54 -2.23 -2.23 -2.11 -2.48                                                       -2.67 -2.51 -3.10 -2.04 -1.97 -3.11 -2.90 -2.72 -3.08 SAM−T02−server 149
150 TsaiLab                                                       -2.05 -1.97 -2.41 -1.58 -1.54 -2.23 -2.23 -2.11 -2.48                                                       -2.67 -2.51 -3.10 -2.04 -1.97 -3.11 -2.90 -2.72 -3.08 TsaiLab 150
151 UCDavisGenome                                                       -2.05 -1.97 -2.41 -1.58 -1.54 -2.23 -2.23 -2.11 -2.48                                                       -2.67 -2.51 -3.10 -2.04 -1.97 -3.11 -2.90 -2.72 -3.08 UCDavisGenome 151
152 Wolfson−FOBIA                                                       -2.05 -1.97 -2.41 -1.58 -1.54 -2.23 -2.23 -2.11 -2.48                                                       -2.67 -2.51 -3.10 -2.04 -1.97 -3.11 -2.90 -2.72 -3.08 Wolfson−FOBIA 152
153 Wolynes                                                       -2.05 -1.97 -2.41 -1.58 -1.54 -2.23 -2.23 -2.11 -2.48                                                       -2.67 -2.51 -3.10 -2.04 -1.97 -3.11 -2.90 -2.72 -3.08 Wolynes 153
154 YASARA                                                       -2.05 -1.97 -2.41 -1.58 -1.54 -2.23 -2.23 -2.11 -2.48                                                       -2.67 -2.51 -3.10 -2.04 -1.97 -3.11 -2.90 -2.72 -3.08 YASARA 154
155 YASARARefine                                                       -2.05 -1.97 -2.41 -1.58 -1.54 -2.23 -2.23 -2.11 -2.48                                                       -2.67 -2.51 -3.10 -2.04 -1.97 -3.11 -2.90 -2.72 -3.08 YASARARefine 155
156 Zhou−SPARKS                                                       -2.05 -1.97 -2.41 -1.58 -1.54 -2.23 -2.23 -2.11 -2.48                                                       -2.67 -2.51 -3.10 -2.04 -1.97 -3.11 -2.90 -2.72 -3.08 Zhou−SPARKS 156
157 dill_ucsf_extended                                                       -2.05 -1.97 -2.41 -1.58 -1.54 -2.23 -2.23 -2.11 -2.48                                                       -2.67 -2.51 -3.10 -2.04 -1.97 -3.11 -2.90 -2.72 -3.08 dill_ucsf_extended 157
158 jacobson                                                       -2.05 -1.97 -2.41 -1.58 -1.54 -2.23 -2.23 -2.11 -2.48                                                       -2.67 -2.51 -3.10 -2.04 -1.97 -3.11 -2.90 -2.72 -3.08 jacobson 158
159 mti                                                       -2.05 -1.97 -2.41 -1.58 -1.54 -2.23 -2.23 -2.11 -2.48                                                       -2.67 -2.51 -3.10 -2.04 -1.97 -3.11 -2.90 -2.72 -3.08 mti 159
160 mufold                                                       -2.05 -1.97 -2.41 -1.58 -1.54 -2.23 -2.23 -2.11 -2.48                                                       -2.67 -2.51 -3.10 -2.04 -1.97 -3.11 -2.90 -2.72 -3.08 mufold 160
161 mumssp                                                       -2.05 -1.97 -2.41 -1.58 -1.54 -2.23 -2.23 -2.11 -2.48                                                       -2.67 -2.51 -3.10 -2.04 -1.97 -3.11 -2.90 -2.72 -3.08 mumssp 161
162 ricardo                                                       -2.05 -1.97 -2.41 -1.58 -1.54 -2.23 -2.23 -2.11 -2.48                                                       -2.67 -2.51 -3.10 -2.04 -1.97 -3.11 -2.90 -2.72 -3.08 ricardo 162
163 rivilo                                                       -2.05 -1.97 -2.41 -1.58 -1.54 -2.23 -2.23 -2.11 -2.48                                                       -2.67 -2.51 -3.10 -2.04 -1.97 -3.11 -2.90 -2.72 -3.08 rivilo 163
164 sessions                                                       -2.05 -1.97 -2.41 -1.58 -1.54 -2.23 -2.23 -2.11 -2.48                                                       -2.67 -2.51 -3.10 -2.04 -1.97 -3.11 -2.90 -2.72 -3.08 sessions 164
165 test_http_server_01                                                       -2.05 -1.97 -2.41 -1.58 -1.54 -2.23 -2.23 -2.11 -2.48                                                       -2.67 -2.51 -3.10 -2.04 -1.97 -3.11 -2.90 -2.72 -3.08 test_http_server_01 165
166 tripos_08                                                       -2.05 -1.97 -2.41 -1.58 -1.54 -2.23 -2.23 -2.11 -2.48                                                       -2.67 -2.51 -3.10 -2.04 -1.97 -3.11 -2.90 -2.72 -3.08 tripos_08 166