T0434

Targets
387 388 389 390
391 392 393 394
395 396 397 398
399 400 401 402
403 404 405 406
407 408 409 410
411 412 413 414
415 416 417 418
419 420 421 422
423 424 425 426
427 428 429 430
431 432 433 434
435 436 437 438
439 440 441 442
443 444 445 446
447 448 449 450
451 452 453 454
455 456 457 458
459 460 461 462
463 464 465 466
467 468 469 470
471 472 473 474
475 476 477 478
479 480 481 482
483 484 485 486
487 488 489 490
491 492 493 494
495 496 497 498
499 500 501 502
503 504 505 506
507 508 509 510
511 512 513 514

T0434

methyltransferase domain of human PR domain-containing protein 1 (PRDM1) from Homo sapiens

Target type: Human/Server

Target sequence:

>T0434 PRDM1, Homo sapiens, 205 residues
MGSSHHHHHHSSGLVPRGSKMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVPKNANRKYFWRIYSRGELHHFIDGFNEEKSNWMRYVNPAHSPREQNLAACQNGMNIYFYTIKPIPANQELLVWYCRDFAERLHYPYPGELTMMNLTQ

Structure:
Method: X-ray, res=1.65Å, R/Rfree=0.20/0.22
Determined by: SGC
PDB ID: 3dal

3dal_A cartoon
Cartoon diagram of 434: 3dal chain A

PyMOL of 3dal

Domains:  PyMOL of domains

Single domain protein. N-terminal (pdb -10 to -1) and C-terminal (pdb 179 to 186) regions protrude away from the structure and can be removed in domain evaluation.

434 domain evaluation plot
Correlation between GDT-TS scores for domain-based evlatuation (without N- and C-term. segments, y, vertical axis) and whole chain GDT-TS (x, horizontal axis).

Each point represents first server model. Green, gray and black points are top 10, bottom 25% and the rest of prediction models. Blue line is the best-fit slope line (intersection 0) to the top 10 server models. Red line is the diagonal. Slope and root mean square y-x distance for the top 10 models (average difference between the domain GDT-TS scores and the whole chain GDT-TS score) are shown above the plot.

Structure classification:

β-clip fold.

CASP category:

Whole chain: Comparative modeling:hard.

1st domain (with N-terminal pdb:-10 to -1 and C-terminal pdb:179-186 removed): Comparative modeling:hard.

Closest templates:

2qpw.

Target sequence - PDB file inconsistencies:

T0434    3dal.pdb    T0434.pdb    PyMOL    PyMOL of domains    

T0434    1 MGSSHHHHHHSSGLVPRGSKMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVPKNANRKYFWRIYSRGELHHFIDGFNEEKSNWMRYVNPAHSPREQNLAACQNGMNIYFYTIKPIPANQELLVWYCRDFAERLHYPYPGELTMMNLTQ 205
           ~~~~~~~~~~||||||||||~~~~~|||||||||||||||||||||||||~~~~~~~~|||||||||||||||||||||||||||||||||||||||||||||||||||~~~|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3dalA  -10 ----------SSGLVPRGSK-----ADMTLWTEAEFEEKCTYIVNDHPWD--------VQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVP---NRKYFWRIYSRGELHHFIDGFNEEKSNWMRYVNPAHSPREQNLAACQNGMNIYFYTIKPIPANQELLVWYCRDFAERLHYPYPGELTMMNLTQ 186

1st domain: target 26-50, 59-109, 113-197 ; pdb 7-31, 40-90, 94-178

Sequence classification:

SET domain in Pfam.

Comments:

This protein is a close homolog of T0435.

Server predictions:

T0434:pdb -10-186:seq 11-205:CM_hard;   alignment

distribution of first scores
First models for T0434: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

434_1:pdb 7-178:seq 26-197:CM_hard;   alignment

distribution of first scores
First models for T0434_1: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

# GROUP ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ ↓ GROUP #
T0434 434_1 T0434 434_1 T0434 434_1 T0434 434_1
First score First Z-score Best score Best Z-score
1 Jones−UCL 56.01 48.37 63.82 62.27 53.78 68.48 1.05 0.76 1.30 1.05 0.77 1.48 56.01 48.37 63.82 62.27 53.78 68.48 1.21 0.61 1.34 1.21 0.61 1.56 Jones−UCL 1
2 MidwayFolding 55.87 44.60 64.37 61.80 49.27 67.23 1.03 0.34 1.35 1.00 0.32 1.35 55.87 46.60 64.37 61.80 51.81 67.23 1.18 0.32 1.41 1.14 0.32 1.39 MidwayFolding 2
3 Softberry 54.75 46.55 63.59 60.56 51.45 65.81 0.90 0.56 1.27 0.88 0.54 1.21 54.75 46.55 63.59 60.56 51.45 65.81 0.98 0.31 1.31 0.93 0.27 1.20 Softberry 3
4 Zhang−Server 54.47 51.49 62.02 60.56 57.25 64.41 0.87 1.11 1.11 0.88 1.12 1.07 57.68 51.58 66.06 64.13 57.35 68.16 1.51 1.14 1.64 1.52 1.14 1.52 Zhang−Server 4
5 mufold 54.47 51.40 62.19 60.56 57.14 64.91 0.87 1.10 1.13 0.88 1.11 1.12 54.47 51.40 62.19 60.56 57.14 64.91 0.93 1.11 1.12 0.93 1.11 1.08 mufold 5
6 A−TASSER 54.33 52.28 59.54 60.40 58.13 62.34 0.86 1.20 0.86 0.86 1.21 0.86 54.33 52.28 59.54 60.40 58.13 62.34 0.90 1.26 0.75 0.91 1.26 0.73 A−TASSER 6
7 Zhang 54.19 49.53 63.57 60.25 55.07 66.15 0.84 0.89 1.27 0.85 0.90 1.24 54.47 50.47 64.02 60.56 56.11 66.34 0.93 0.96 1.37 0.93 0.96 1.27 Zhang 7
8 Sternberg 54.05 49.58 63.10 60.09 55.12 65.62 0.83 0.90 1.22 0.83 0.91 1.19 54.05 49.58 63.10 60.09 55.12 65.62 0.85 0.81 1.24 0.86 0.81 1.17 Sternberg 8
9 FAMS−multi 54.05 48.74 61.55 60.09 54.19 64.25 0.83 0.80 1.07 0.83 0.81 1.05 54.05 50.37 61.55 60.09 56.00 64.25 0.85 0.94 1.03 0.86 0.94 0.99 FAMS−multi 9
10 SHORTLE 53.91 49.72 52.18 59.94 55.28 57.49 0.81 0.91 0.11 0.82 0.92 0.37 53.91 49.72 52.18 59.94 55.28 57.49 0.83 0.84 -0.25 0.83 0.84 0.08 SHORTLE 10
11 LevittGroup 53.91 48.70 57.91 59.94 54.14 63.34 0.81 0.80 0.69 0.82 0.81 0.96 53.91 48.98 57.91 59.94 54.45 63.34 0.83 0.71 0.53 0.83 0.71 0.87 LevittGroup 11
12 HHpred4 53.77 46.70 59.09 59.78 51.91 61.55 0.80 0.58 0.81 0.80 0.59 0.78 53.77 46.70 59.09 59.78 51.91 61.55 0.80 0.34 0.69 0.81 0.34 0.63 HHpred4 12
13 COMA 53.77 44.65 54.11 59.78 49.64 59.01 0.80 0.35 0.30 0.80 0.36 0.52 53.77 44.65 54.86 59.78 49.64 59.78 0.80 0.00 0.11 0.81 0.00 0.39 COMA 13
14 IBT_LT 53.63 50.19 57.52 59.63 55.80 61.49 0.78 0.96 0.65 0.79 0.98 0.77 53.63 50.19 57.52 59.63 55.80 61.49 0.78 0.91 0.48 0.78 0.91 0.62 IBT_LT 14
15 HHpred2 53.63 49.07 59.03 59.63 54.55 61.73 0.78 0.84 0.81 0.79 0.85 0.80 53.63 49.07 59.03 59.63 54.55 61.73 0.78 0.73 0.68 0.78 0.73 0.65 HHpred2 15
16 POEM 53.49 50.70 61.28 59.47 56.37 64.06 0.76 1.02 1.04 0.77 1.03 1.03 54.05 50.70 61.46 60.09 56.37 64.36 0.85 1.00 1.02 0.86 1.00 1.00 POEM 16
17 Elofsson 53.49 50.05 58.54 59.47 55.64 61.66 0.76 0.95 0.76 0.77 0.96 0.79 53.63 50.05 58.80 59.63 55.64 61.80 0.78 0.89 0.65 0.78 0.89 0.66 Elofsson 17
18 RAPTOR 53.49 47.25 58.85 59.47 52.54 61.16 0.76 0.64 0.79 0.77 0.65 0.74 54.19 49.77 60.34 60.25 55.33 63.33 0.88 0.84 0.86 0.88 0.84 0.87 RAPTOR 18
19 fais−server 53.35 49.81 58.96 59.32 55.38 61.89 0.75 0.92 0.80 0.75 0.93 0.81 54.61 49.81 63.84 60.71 55.38 66.92 0.95 0.85 1.34 0.96 0.85 1.35 fais−server 19
20 pro−sp3−TASSER 53.35 49.26 61.44 59.16 54.61 64.00 0.75 0.86 1.05 0.74 0.86 1.03 53.35 49.26 61.44 59.16 54.61 64.00 0.72 0.76 1.01 0.71 0.74 0.96 pro−sp3−TASSER 20
21 FFASsuboptimal 53.21 50.70 54.53 59.16 56.37 59.45 0.73 1.02 0.35 0.74 1.03 0.57 53.21 50.74 54.74 59.16 56.42 59.66 0.70 1.00 0.10 0.71 1.00 0.37 FFASsuboptimal 21
22 HHpred5 53.21 49.77 58.65 59.16 55.33 61.25 0.73 0.92 0.77 0.74 0.93 0.75 53.21 49.77 58.65 59.16 55.33 61.25 0.70 0.84 0.63 0.71 0.84 0.59 HHpred5 22
23 COMA−M 53.21 49.58 54.62 59.16 55.12 59.53 0.73 0.90 0.36 0.74 0.91 0.57 54.05 49.58 54.86 60.09 55.12 59.78 0.85 0.81 0.11 0.86 0.81 0.39 COMA−M 23
24 FALCON_CONSENSUS 53.21 49.30 61.68 59.01 54.66 64.61 0.73 0.87 1.08 0.72 0.86 1.09 53.35 49.30 62.20 59.32 54.76 64.92 0.72 0.77 1.12 0.73 0.76 1.08 FALCON_CONSENSUS 24
25 FALCON 53.21 49.30 61.68 59.01 54.66 64.61 0.73 0.87 1.08 0.72 0.86 1.09 53.35 49.30 62.20 59.32 54.76 64.92 0.72 0.77 1.12 0.73 0.76 1.08 FALCON 25
26 PSI 53.21 48.65 62.45 59.16 54.09 63.66 0.73 0.79 1.16 0.74 0.80 0.99 53.21 48.74 63.39 59.16 54.19 64.85 0.70 0.67 1.28 0.71 0.68 1.07 PSI 26
27 3DShot1 53.21 48.37 56.69 59.16 53.78 59.88 0.73 0.76 0.57 0.74 0.77 0.61 53.21 48.37 56.69 59.16 53.78 59.88 0.70 0.61 0.36 0.71 0.61 0.40 3DShot1 27
28 fais@hgc 53.21 47.77 61.89 59.01 52.95 65.31 0.73 0.70 1.10 0.72 0.69 1.16 57.68 51.49 66.06 64.13 57.25 68.51 1.51 1.13 1.64 1.52 1.13 1.56 fais@hgc 28
29 nFOLD3 53.21 47.25 58.69 59.01 52.38 61.10 0.73 0.64 0.77 0.72 0.63 0.73 53.77 47.81 58.81 59.78 53.16 61.49 0.80 0.52 0.65 0.81 0.52 0.62 nFOLD3 29
30 TASSER 53.07 50.37 60.69 59.16 56.16 64.13 0.72 0.98 0.98 0.74 1.01 1.04 53.91 50.37 60.69 59.94 56.16 64.13 0.83 0.94 0.91 0.83 0.97 0.97 TASSER 30
31 keasar−server 53.07 50.37 60.76 59.01 56.00 62.29 0.72 0.98 0.99 0.72 1.00 0.85 53.91 50.37 61.70 59.94 56.00 63.66 0.83 0.94 1.05 0.83 0.94 0.91 keasar−server 31
32 FFASstandard 53.07 50.19 52.18 59.01 55.80 57.03 0.72 0.96 0.11 0.72 0.98 0.32 53.07 50.28 52.18 59.01 55.90 57.03 0.67 0.93 -0.25 0.68 0.93 0.02 FFASstandard 32
33 MULTICOM 52.93 45.02 59.66 58.54 50.67 62.44 0.70 0.39 0.87 0.68 0.46 0.87 54.05 49.95 62.69 60.09 55.54 65.34 0.85 0.87 1.18 0.86 0.87 1.14 MULTICOM 33
34 FUGUE_KM 52.79 50.47 53.35 58.70 56.11 58.23 0.69 1.00 0.23 0.69 1.01 0.44 52.79 50.47 53.35 58.70 56.11 58.23 0.62 0.96 -0.09 0.63 0.96 0.18 FUGUE_KM 34
35 GS−MetaServer2 52.79 50.37 51.48 58.70 56.00 56.30 0.69 0.98 0.03 0.69 1.00 0.25 52.79 50.37 51.48 58.70 56.00 56.30 0.62 0.94 -0.35 0.63 0.94 -0.08 GS−MetaServer2 35
36 Phyre2 52.79 50.19 58.76 58.70 55.80 61.54 0.69 0.96 0.78 0.69 0.98 0.78 52.79 50.19 58.76 58.70 55.80 61.54 0.62 0.91 0.65 0.63 0.91 0.62 Phyre2 36
37 DBAKER 52.79 46.18 60.61 58.70 51.35 63.21 0.69 0.52 0.97 0.69 0.53 0.95 53.49 48.37 64.05 59.47 53.78 67.27 0.75 0.61 1.37 0.76 0.61 1.40 DBAKER 37
38 pipe_int 52.65 48.56 59.36 58.38 53.83 60.83 0.67 0.78 0.84 0.66 0.78 0.71 52.65 48.56 59.36 58.38 53.83 60.83 0.60 0.64 0.73 0.58 0.62 0.53 pipe_int 38
39 SAM−T02−server 52.51 50.19 51.38 58.38 55.80 56.19 0.66 0.96 0.02 0.66 0.98 0.24 52.51 50.19 51.38 58.38 55.80 56.19 0.57 0.91 -0.36 0.58 0.91 -0.10 SAM−T02−server 39
40 FFASflextemplate 52.23 48.23 50.21 58.08 53.62 54.99 0.62 0.75 -0.10 0.63 0.76 0.12 52.23 48.23 50.59 58.08 53.62 55.39 0.52 0.59 -0.47 0.53 0.59 -0.21 FFASflextemplate 40
41 PS2−manual 52.23 46.74 60.82 57.92 51.81 63.37 0.62 0.58 0.99 0.61 0.58 0.96 52.23 46.74 60.82 57.92 51.81 63.37 0.52 0.34 0.93 0.50 0.32 0.87 PS2−manual 41
42 Phragment 51.82 49.12 59.35 56.99 53.99 61.79 0.58 0.85 0.84 0.52 0.79 0.80 51.82 49.12 59.35 56.99 53.99 61.79 0.45 0.74 0.73 0.35 0.65 0.66 Phragment 42
43 LEE 51.26 48.65 59.06 56.99 54.09 61.74 0.52 0.79 0.81 0.52 0.80 0.80 52.51 50.28 59.83 58.38 55.90 62.58 0.57 0.93 0.79 0.58 0.93 0.76 LEE 43
44 CBSU 50.84 49.07 57.48 56.68 54.71 58.78 0.47 0.84 0.65 0.49 0.87 0.50 53.49 49.77 59.04 59.32 54.71 61.11 0.75 0.84 0.68 0.73 0.75 0.57 CBSU 44
45 Pushchino 50.70 44.65 46.19 56.37 49.64 50.85 0.45 0.35 -0.51 0.46 0.36 -0.30 50.70 44.65 46.19 56.37 49.64 50.85 0.24 0.00 -1.07 0.25 0.00 -0.82 Pushchino 45
46 METATASSER 50.28 44.04 54.36 55.90 48.97 56.73 0.41 0.28 0.33 0.41 0.29 0.29 53.07 50.37 60.69 59.16 56.16 63.73 0.67 0.94 0.91 0.71 0.97 0.92 METATASSER 46
47 PS2−server 50.14 44.83 57.95 55.74 49.84 60.00 0.39 0.37 0.70 0.40 0.38 0.62 54.19 48.32 57.95 60.25 53.73 60.00 0.88 0.60 0.54 0.88 0.61 0.42 PS2−server 47
48 fams−ace2 50.00 43.34 53.65 55.59 48.19 56.31 0.38 0.20 0.26 0.38 0.21 0.25 53.91 50.56 61.31 59.94 56.21 63.98 0.83 0.97 1.00 0.83 0.97 0.95 fams−ace2 48
49 Zico 49.86 44.23 54.58 55.44 49.17 57.29 0.36 0.30 0.35 0.37 0.31 0.35 49.86 44.23 58.64 55.44 49.17 61.47 0.09 -0.07 0.63 0.10 -0.07 0.61 Zico 49
50 ZicoFullSTP 49.86 44.23 54.58 55.44 49.17 57.29 0.36 0.30 0.35 0.37 0.31 0.35 52.51 47.49 58.64 58.38 54.97 61.47 0.57 0.47 0.63 0.58 0.79 0.61 ZicoFullSTP 50
51 ZicoFullSTPFullData 49.86 44.23 54.58 55.44 49.17 57.29 0.36 0.30 0.35 0.37 0.31 0.35 49.86 44.23 54.58 55.44 49.17 57.29 0.09 -0.07 0.07 0.10 -0.07 0.05 ZicoFullSTPFullData 51
52 Chicken_George 49.72 43.34 57.61 55.28 48.19 60.62 0.34 0.20 0.66 0.35 0.21 0.68 52.65 49.58 59.82 58.54 55.12 62.64 0.60 0.81 0.79 0.61 0.81 0.77 Chicken_George 52
53 GeneSilico 49.58 42.97 58.99 55.12 47.77 61.98 0.33 0.16 0.80 0.33 0.17 0.82 50.70 45.95 58.99 56.37 51.09 61.98 0.24 0.21 0.68 0.25 0.22 0.68 GeneSilico 53
54 Poing 49.44 47.86 55.27 54.97 53.21 57.23 0.31 0.71 0.42 0.32 0.72 0.34 49.44 47.86 55.98 54.97 53.21 57.69 0.02 0.53 0.27 0.02 0.53 0.10 Poing 54
55 TJ_Jiang 49.16 39.76 57.88 54.66 44.20 59.80 0.28 -0.19 0.69 0.29 -0.19 0.60 54.19 48.42 64.83 60.25 53.83 67.67 0.88 0.62 1.48 0.88 0.62 1.45 TJ_Jiang 55
56 Jiang_Zhu 48.74 42.32 55.79 54.35 42.86 58.23 0.24 0.09 0.48 0.26 -0.32 0.44 53.91 50.65 60.56 59.94 56.31 63.43 0.83 0.99 0.89 0.83 0.99 0.88 Jiang_Zhu 56
57 FEIG 48.32 43.95 50.03 53.73 48.86 52.67 0.19 0.27 -0.11 0.19 0.28 -0.12 49.16 44.23 51.70 54.50 49.02 54.11 -0.04 -0.07 -0.32 -0.05 -0.09 -0.38 FEIG 57
58 McGuffin 47.91 43.53 53.27 53.26 48.40 55.60 0.14 0.22 0.22 0.15 0.23 0.18 53.21 49.30 63.39 59.16 54.66 65.24 0.70 0.77 1.28 0.71 0.74 1.12 McGuffin 58
59 ABIpro 47.63 39.76 57.97 52.80 44.05 60.54 0.11 -0.19 0.70 0.10 -0.20 0.68 47.63 42.97 57.97 52.80 47.77 60.54 -0.31 -0.28 0.54 -0.33 -0.27 0.49 ABIpro 59
60 Kolinski 47.35 41.90 49.66 52.64 46.58 52.53 0.08 0.04 -0.15 0.08 0.05 -0.13 49.58 46.23 51.55 54.81 51.09 53.56 0.04 0.26 -0.34 -0.00 0.22 -0.45 Kolinski 60
61 Phyre_de_novo 47.35 39.99 47.50 52.64 44.46 49.68 0.08 -0.17 -0.37 0.08 -0.16 -0.42 47.35 41.90 47.68 52.64 46.58 49.68 -0.36 -0.45 -0.87 -0.36 -0.45 -0.98 Phyre_de_novo 61
62 PRI−Yang−KiharA 47.21 43.11 50.83 52.48 47.93 54.70 0.07 0.18 -0.03 0.07 0.19 0.09 47.21 43.11 50.83 52.48 47.93 54.70 -0.39 -0.25 -0.44 -0.38 -0.25 -0.30 PRI−Yang−KiharA 62
63 BAKER−ROBETTA 47.07 42.32 56.88 52.33 47.05 59.46 0.05 0.09 0.59 0.05 0.10 0.57 47.35 43.20 58.07 52.48 47.98 60.19 -0.36 -0.24 0.55 -0.38 -0.24 0.44 BAKER−ROBETTA 63
64 MUSTER 46.93 42.64 55.49 52.17 47.41 57.68 0.03 0.13 0.45 0.04 0.13 0.39 53.21 50.05 60.82 59.16 55.64 62.60 0.70 0.89 0.93 0.71 0.89 0.77 MUSTER 64
65 forecast 46.79 41.85 53.84 52.02 46.53 56.14 0.02 0.04 0.28 0.02 0.05 0.23 46.93 43.06 53.90 52.17 47.88 56.72 -0.44 -0.26 -0.02 -0.43 -0.26 -0.03 forecast 65
66 SAM−T06−server 46.65 39.20 51.67 51.55 43.27 52.66 0.00 -0.26 0.05 -0.03 -0.28 -0.12 52.37 48.84 51.67 58.23 54.30 56.27 0.55 0.69 -0.32 0.55 0.69 -0.09 SAM−T06−server 66
67 Bates_BMM 46.65 38.73 48.54 51.86 43.06 49.51 0.00 -0.31 -0.27 0.01 -0.30 -0.44 50.70 47.44 57.15 56.37 52.90 58.92 0.24 0.46 0.43 0.25 0.48 0.27 Bates_BMM 67
68 GeneSilicoMetaServer 46.37 43.67 43.71 51.24 48.24 46.06 -0.03 0.24 -0.76 -0.06 0.22 -0.79 53.07 43.67 53.71 59.01 48.24 58.60 0.67 -0.16 -0.04 0.68 -0.20 0.23 GeneSilicoMetaServer 68
69 AMU−Biology 46.37 40.32 46.88 51.55 44.82 49.45 -0.03 -0.13 -0.44 -0.03 -0.13 -0.44 46.37 40.32 46.88 51.55 44.82 49.45 -0.54 -0.71 -0.98 -0.53 -0.71 -1.01 AMU−Biology 69
70 SAM−T08−human 46.23 39.80 50.51 51.40 44.26 52.73 -0.04 -0.19 -0.06 -0.04 -0.18 -0.11 46.79 41.02 50.55 51.86 45.45 52.76 -0.47 -0.60 -0.48 -0.48 -0.62 -0.56 SAM−T08−human 70
71 3DShot2 46.09 39.94 46.57 51.24 44.41 48.77 -0.06 -0.17 -0.47 -0.06 -0.17 -0.51 46.09 39.94 46.57 51.24 44.41 48.77 -0.59 -0.78 -1.02 -0.59 -0.77 -1.10 3DShot2 71
72 SAM−T08−server 45.81 37.62 48.29 50.93 41.82 49.77 -0.09 -0.43 -0.29 -0.09 -0.43 -0.41 45.81 39.66 48.29 50.93 44.10 49.95 -0.64 -0.82 -0.79 -0.64 -0.81 -0.94 SAM−T08−server 72
73 Frankenstein 45.53 43.76 44.80 50.78 48.81 46.83 -0.12 0.25 -0.65 -0.10 0.27 -0.71 46.79 43.76 50.08 52.02 48.81 52.55 -0.47 -0.15 -0.54 -0.46 -0.12 -0.59 Frankenstein 73
74 FAMSD 45.39 42.41 51.80 50.47 47.15 54.67 -0.14 0.10 0.07 -0.13 0.11 0.08 46.93 42.74 51.87 52.17 47.52 55.76 -0.44 -0.31 -0.30 -0.43 -0.31 -0.16 FAMSD 74
75 BioSerf 45.39 39.34 53.62 50.47 43.74 54.30 -0.14 -0.24 0.25 -0.13 -0.23 0.05 45.39 39.34 53.62 50.47 43.74 54.30 -0.72 -0.87 -0.06 -0.71 -0.87 -0.35 BioSerf 75
76 FrankensteinLong 45.11 36.27 46.44 50.16 40.32 48.85 -0.17 -0.58 -0.48 -0.16 -0.58 -0.51 46.93 40.13 49.34 51.55 46.27 52.25 -0.44 -0.74 -0.64 -0.53 -0.49 -0.63 FrankensteinLong 76
77 3Dpro 44.97 41.71 50.08 50.00 46.38 51.55 -0.18 0.02 -0.11 -0.18 0.03 -0.23 44.97 41.71 50.44 50.00 46.38 52.11 -0.80 -0.48 -0.49 -0.79 -0.48 -0.65 3Dpro 77
78 SAMUDRALA 44.97 41.62 48.36 50.00 46.27 50.72 -0.18 0.01 -0.28 -0.18 0.02 -0.32 45.25 42.83 48.69 50.31 47.62 51.20 -0.74 -0.30 -0.73 -0.74 -0.29 -0.77 SAMUDRALA 78
79 CpHModels 44.97 41.25 40.56 50.00 45.86 45.05 -0.18 -0.03 -1.08 -0.18 -0.02 -0.89 44.97 41.25 40.56 50.00 45.86 45.05 -0.80 -0.56 -1.84 -0.79 -0.55 -1.60 CpHModels 79
80 GS−KudlatyPred 44.69 37.99 46.36 49.53 42.08 48.34 -0.21 -0.39 -0.49 -0.23 -0.40 -0.56 44.69 37.99 46.36 49.53 42.08 48.34 -0.85 -1.10 -1.05 -0.86 -1.11 -1.16 GS−KudlatyPred 80
81 MULTICOM−RANK 44.69 36.03 46.86 49.69 40.06 48.54 -0.21 -0.61 -0.44 -0.21 -0.60 -0.54 45.39 42.04 47.21 50.47 46.58 48.87 -0.72 -0.43 -0.93 -0.71 -0.45 -1.09 MULTICOM−RANK 81
82 3D−JIGSAW_AEP 44.55 35.99 44.83 49.53 40.42 47.07 -0.23 -0.61 -0.65 -0.23 -0.57 -0.69 44.97 38.45 45.42 49.84 42.75 47.66 -0.80 -1.02 -1.18 -0.81 -1.01 -1.25 3D−JIGSAW_AEP 82
83 Distill 44.41 35.38 50.84 49.38 39.34 53.84 -0.25 -0.68 -0.03 -0.24 -0.68 -0.00 48.32 42.46 53.26 53.57 47.05 56.39 -0.19 -0.36 -0.11 -0.21 -0.38 -0.07 Distill 83
84 MULTICOM−REFINE 44.13 40.60 46.63 48.76 44.82 48.60 -0.28 -0.10 -0.46 -0.31 -0.13 -0.53 45.11 40.60 50.03 50.16 44.82 51.63 -0.77 -0.67 -0.55 -0.76 -0.71 -0.71 MULTICOM−REFINE 84
85 MUProt 44.13 40.60 46.63 48.76 44.82 48.60 -0.28 -0.10 -0.46 -0.31 -0.13 -0.53 45.25 41.57 49.86 50.16 45.91 51.65 -0.74 -0.51 -0.57 -0.76 -0.55 -0.71 MUProt 85
86 circle 44.13 38.36 46.07 49.07 42.13 47.17 -0.28 -0.35 -0.52 -0.27 -0.40 -0.68 52.65 50.79 51.56 58.54 56.47 56.38 0.60 1.01 -0.34 0.61 1.01 -0.07 circle 86
87 MULTICOM−CMFR 43.99 40.83 45.14 48.76 45.24 47.02 -0.29 -0.08 -0.61 -0.31 -0.08 -0.69 53.21 44.41 58.62 59.16 49.69 60.63 0.70 -0.04 0.63 0.71 0.01 0.50 MULTICOM−CMFR 87
88 ProtAnG 43.99 35.52 48.63 48.91 39.49 51.39 -0.29 -0.67 -0.26 -0.29 -0.66 -0.25 43.99 35.52 48.63 48.91 39.49 51.39 -0.97 -1.50 -0.74 -0.97 -1.50 -0.75 ProtAnG 88
89 3DShotMQ 43.99 34.87 45.11 48.91 38.77 47.19 -0.29 -0.74 -0.62 -0.29 -0.73 -0.67 43.99 34.87 45.11 48.91 38.77 47.19 -0.97 -1.61 -1.22 -0.97 -1.60 -1.31 3DShotMQ 89
90 Pcons_multi 43.85 38.45 48.13 48.91 42.91 49.25 -0.31 -0.34 -0.31 -0.29 -0.32 -0.47 45.95 40.27 48.73 50.93 44.67 50.54 -0.62 -0.72 -0.73 -0.64 -0.73 -0.86 Pcons_multi 90
91 Bilab−UT 43.85 37.34 44.29 48.45 38.72 47.54 -0.31 -0.46 -0.70 -0.34 -0.74 -0.64 48.18 42.23 46.33 52.80 46.22 48.99 -0.21 -0.40 -1.05 -0.33 -0.50 -1.07 Bilab−UT 91
92 Pcons_local 43.72 37.94 42.18 48.60 42.18 46.72 -0.32 -0.40 -0.92 -0.32 -0.39 -0.72 44.27 39.34 42.18 49.22 43.74 46.72 -0.92 -0.87 -1.62 -0.91 -0.87 -1.38 Pcons_local 92
93 Pcons_dot_net 43.58 38.45 47.25 48.45 42.75 48.82 -0.34 -0.34 -0.40 -0.34 -0.33 -0.51 47.91 43.53 53.27 53.26 48.40 55.10 -0.26 -0.18 -0.10 -0.26 -0.18 -0.24 Pcons_dot_net 93
94 3D−JIGSAW_V3 43.58 36.97 43.32 48.45 41.10 45.47 -0.34 -0.50 -0.80 -0.34 -0.50 -0.85 43.58 38.59 44.39 48.60 42.91 47.03 -1.05 -1.00 -1.32 -1.02 -0.99 -1.33 3D−JIGSAW_V3 94
95 Zhou−SPARKS 42.88 37.38 46.83 47.67 41.56 48.93 -0.42 -0.46 -0.44 -0.41 -0.45 -0.50 42.88 37.38 46.83 47.67 41.56 48.93 -1.17 -1.20 -0.98 -1.17 -1.19 -1.08 Zhou−SPARKS 95
96 fleil 42.74 36.17 40.99 47.36 40.06 43.55 -0.43 -0.59 -1.04 -0.45 -0.60 -1.04 42.74 37.71 40.99 47.52 40.06 43.55 -1.20 -1.14 -1.78 -1.19 -1.41 -1.80 fleil 96
97 Hao_Kihara 42.18 37.90 40.88 46.74 41.98 43.35 -0.49 -0.40 -1.05 -0.51 -0.41 -1.06 53.35 50.56 53.66 59.32 56.21 59.00 0.72 0.97 -0.05 0.73 0.97 0.28 Hao_Kihara 97
98 StruPPi 40.36 32.73 47.29 44.72 36.23 50.50 -0.70 -0.98 -0.39 -0.71 -0.99 -0.34 40.36 32.73 47.29 44.72 36.23 50.50 -1.63 -1.96 -0.92 -1.65 -1.98 -0.87 StruPPi 98
99 MULTICOM−CLUSTER 39.80 34.22 48.25 44.41 38.20 50.57 -0.76 -0.81 -0.30 -0.74 -0.79 -0.33 45.67 40.55 50.07 50.78 45.08 51.75 -0.67 -0.67 -0.54 -0.66 -0.67 -0.70 MULTICOM−CLUSTER 99
100 xianmingpan 38.41 32.08 39.72 42.86 35.82 43.31 -0.91 -1.05 -1.17 -0.90 -1.03 -1.07 38.41 32.08 39.72 42.86 35.82 43.31 -1.98 -2.07 -1.96 -1.95 -2.04 -1.84 xianmingpan 100
101 SMEG−CCP 38.13 28.68 46.50 42.55 32.04 49.09 -0.95 -1.43 -0.48 -0.93 -1.41 -0.48 38.13 28.68 46.50 42.55 32.04 49.09 -2.04 -2.63 -1.03 -2.00 -2.59 -1.06 SMEG−CCP 101
102 rehtnap 36.31 31.56 24.37 40.37 35.09 28.38 -1.15 -1.11 -2.74 -1.15 -1.10 -2.58 36.73 32.45 24.37 40.84 36.08 28.38 -2.29 -2.01 -4.06 -2.28 -2.00 -3.85 rehtnap 102
103 FOLDpro 34.92 31.29 31.66 38.82 34.78 33.34 -1.30 -1.14 -1.99 -1.30 -1.13 -2.07 35.48 31.29 34.64 39.29 34.78 36.50 -2.52 -2.20 -2.65 -2.53 -2.19 -2.75 FOLDpro 103
104 EB_AMU_Physics 29.89 22.81 23.81 33.38 25.52 26.57 -1.86 -2.08 -2.80 -1.85 -2.06 -2.76 38.27 34.17 35.66 42.55 37.99 37.13 -2.01 -1.73 -2.51 -2.00 -1.72 -2.67 EB_AMU_Physics 104
105 MUFOLD−Server 25.28 21.37 19.26 28.11 23.55 22.25 -2.38 -2.24 -3.26 -2.38 -2.26 -3.19 25.28 21.46 19.39 28.11 23.86 22.39 -4.37 -3.82 -4.74 -4.36 -3.80 -4.66 MUFOLD−Server 105
106 panther_server 23.05 17.36 16.08 25.62 19.31 19.46 -2.62 -2.68 -3.59 -2.63 -2.69 -3.48 43.58 38.13 42.04 48.45 42.39 44.68 -1.05 -1.07 -1.64 -1.04 -1.07 -1.65 panther_server 106
107 DistillSN 16.06 13.45 16.39 17.86 14.96 18.44 -3.40 -3.12 -3.56 -3.41 -3.12 -3.58 16.06 13.45 16.59 17.86 14.96 19.16 -6.04 -5.14 -5.12 -6.03 -5.12 -5.09 DistillSN 107
108 JIVE08 15.64 13.50 29.34 17.39 15.53 31.95 -3.45 -3.11 -2.23 -3.45 -3.06 -2.21 48.46 45.02 52.67 53.88 50.05 55.75 -0.16 0.06 -0.19 -0.15 0.06 -0.16 JIVE08 108
109 MUFOLD−MD 15.50 13.64 29.10 17.24 15.17 31.12 -3.46 -3.10 -2.26 -3.47 -3.10 -2.30 16.20 14.99 29.50 17.24 15.17 31.12 -6.01 -4.88 -3.35 -6.13 -5.09 -3.48 MUFOLD−MD 109
110 POEMQA 15.08 12.76 28.53 16.93 15.37 30.32 -3.51 -3.19 -2.31 -3.50 -3.08 -2.38 51.82 48.56 58.37 57.61 53.99 61.85 0.45 0.64 0.59 0.45 0.65 0.67 POEMQA 110
111 RBO−Proteus 14.66 12.62 28.42 16.30 14.03 29.47 -3.56 -3.21 -2.33 -3.56 -3.22 -2.46 15.64 13.59 29.41 17.39 15.53 31.20 -6.11 -5.11 -3.37 -6.11 -5.03 -3.47 RBO−Proteus 111
112 mariner1 14.11 11.69 19.07 15.68 13.10 21.58 -3.62 -3.31 -3.28 -3.62 -3.31 -3.26 36.59 29.33 39.83 40.68 32.61 43.35 -2.31 -2.52 -1.94 -2.31 -2.51 -1.83 mariner1 112
113 Scheraga 13.27 11.03 18.44 14.60 12.11 20.99 -3.71 -3.39 -3.35 -3.73 -3.41 -3.32 13.27 11.22 21.64 14.91 12.94 24.04 -6.54 -5.50 -4.43 -6.51 -5.41 -4.44 Scheraga 113
114 LOOPP_Server 11.73 9.68 10.59 12.89 10.61 12.96 -3.88 -3.54 -4.15 -3.90 -3.56 -4.13 40.78 35.20 40.05 45.19 38.98 43.34 -1.56 -1.56 -1.91 -1.57 -1.57 -1.83 LOOPP_Server 114
115 MeilerLabRene 11.31 9.50 17.44 12.58 10.56 20.06 -3.93 -3.56 -3.45 -3.93 -3.56 -3.42 13.27 12.20 18.93 14.91 13.72 21.12 -6.54 -5.34 -4.80 -6.51 -5.30 -4.83 MeilerLabRene 115
116 schenk−torda−server 11.03 9.78 11.52 12.42 11.03 12.20 -3.96 -3.53 -4.06 -3.95 -3.52 -4.21 11.03 9.78 12.01 12.42 11.03 12.50 -6.95 -5.74 -5.75 -6.92 -5.70 -5.99 schenk−torda−server 116
117 RANDOM 10.01 8.40 10.01 11.72 10.07 11.72 -4.07 -3.68 -4.21 -4.02 -3.61 -4.26 10.01 8.40 10.01 11.72 10.07 11.72 -7.14 -5.97 -6.02 -7.03 -5.84 -6.10 RANDOM 117
118 TWPPLAB 9.92 8.66 14.17 11.03 9.63 15.64 -4.08 -3.65 -3.79 -4.09 -3.66 -3.86 9.92 8.66 14.17 11.03 9.63 15.64 -7.15 -5.93 -5.45 -7.14 -5.90 -5.57 TWPPLAB 118
119 OLGAFS 9.92 8.10 2.33 10.71 9.37 3.29 -4.08 -3.71 -5.00 -4.12 -3.68 -5.11 10.89 8.94 2.43 12.11 9.94 5.72 -6.98 -5.88 -7.06 -6.97 -5.86 -6.91 OLGAFS 119
120 ACOMPMOD 9.78 7.96 9.60 10.40 8.59 10.70 -4.10 -3.73 -4.25 -4.15 -3.76 -4.36 46.51 43.44 48.40 51.40 47.98 50.43 -0.52 -0.20 -0.77 -0.56 -0.24 -0.87 ACOMPMOD 120
121 psiphifoldings 8.94 8.24 16.43 9.32 8.49 17.88 -4.19 -3.70 -3.55 -4.26 -3.77 -3.64 8.94 8.24 16.43 9.32 8.49 17.88 -7.33 -6.00 -5.14 -7.42 -6.07 -5.27 psiphifoldings 121
122 mGenTHREADER 8.94 7.87 56.00 9.01 7.76 59.67 -4.19 -3.74 0.50 -4.29 -3.84 0.59 8.94 7.87 56.00 9.01 7.76 59.67 -7.33 -6.06 0.27 -7.47 -6.18 0.37 mGenTHREADER 122
123 DelCLab 8.94 7.82 9.39 9.32 9.01 11.22 -4.19 -3.74 -4.27 -4.26 -3.72 -4.31 37.15 33.24 34.84 41.46 37.11 35.10 -2.21 -1.88 -2.62 -2.18 -1.85 -2.94 DelCLab 123
124 Sasaki−Cetin−Sasai 8.24 7.40 -8.07 9.32 8.38 -6.00 -4.27 -3.79 -6.06 -4.26 -3.78 -6.05 9.50 8.75 -6.40 10.40 9.58 -4.29 -7.23 -5.91 -8.26 -7.25 -5.91 -8.26 Sasaki−Cetin−Sasai 124
125 Abagyan                                     -4.07 -3.68 -4.21 -4.02 -3.61 -4.26                                     -7.14 -5.97 -6.02 -7.03 -5.84 -6.10 Abagyan 125
126 BHAGEERATH                                     -4.07 -3.68 -4.21 -4.02 -3.61 -4.26                                     -7.14 -5.97 -6.02 -7.03 -5.84 -6.10 BHAGEERATH 126
127 FEIG_REFINE                                     -4.07 -3.68 -4.21 -4.02 -3.61 -4.26                                     -7.14 -5.97 -6.02 -7.03 -5.84 -6.10 FEIG_REFINE 127
128 FLOUDAS                                     -4.07 -3.68 -4.21 -4.02 -3.61 -4.26                                     -7.14 -5.97 -6.02 -7.03 -5.84 -6.10 FLOUDAS 128
129 Fiser−M4T                                     -4.07 -3.68 -4.21 -4.02 -3.61 -4.26                                     -7.14 -5.97 -6.02 -7.03 -5.84 -6.10 Fiser−M4T 129
130 HCA                                     -4.07 -3.68 -4.21 -4.02 -3.61 -4.26                                     -7.14 -5.97 -6.02 -7.03 -5.84 -6.10 HCA 130
131 Handl−Lovell                                     -4.07 -3.68 -4.21 -4.02 -3.61 -4.26                                     -7.14 -5.97 -6.02 -7.03 -5.84 -6.10 Handl−Lovell 131
132 KudlatyPredHuman                                     -4.07 -3.68 -4.21 -4.02 -3.61 -4.26                                     -7.14 -5.97 -6.02 -7.03 -5.84 -6.10 KudlatyPredHuman 132
133 LEE−SERVER                                     -4.07 -3.68 -4.21 -4.02 -3.61 -4.26                                     -7.14 -5.97 -6.02 -7.03 -5.84 -6.10 LEE−SERVER 133
134 Linnolt−UH−CMB                                     -4.07 -3.68 -4.21 -4.02 -3.61 -4.26                                     -7.14 -5.97 -6.02 -7.03 -5.84 -6.10 Linnolt−UH−CMB 134
135 NIM2                                     -4.07 -3.68 -4.21 -4.02 -3.61 -4.26                                     -7.14 -5.97 -6.02 -7.03 -5.84 -6.10 NIM2 135
136 Nano_team                                     -4.07 -3.68 -4.21 -4.02 -3.61 -4.26                                     -7.14 -5.97 -6.02 -7.03 -5.84 -6.10 Nano_team 136
137 NirBenTal                                     -4.07 -3.68 -4.21 -4.02 -3.61 -4.26                                     -7.14 -5.97 -6.02 -7.03 -5.84 -6.10 NirBenTal 137
138 Ozkan−Shell                                     -4.07 -3.68 -4.21 -4.02 -3.61 -4.26                                     -7.14 -5.97 -6.02 -7.03 -5.84 -6.10 Ozkan−Shell 138
139 PHAISTOS                                     -4.07 -3.68 -4.21 -4.02 -3.61 -4.26                                     -7.14 -5.97 -6.02 -7.03 -5.84 -6.10 PHAISTOS 139
140 POISE                                     -4.07 -3.68 -4.21 -4.02 -3.61 -4.26                                     -7.14 -5.97 -6.02 -7.03 -5.84 -6.10 POISE 140
141 PZ−UAM                                     -4.07 -3.68 -4.21 -4.02 -3.61 -4.26                                     -7.14 -5.97 -6.02 -7.03 -5.84 -6.10 PZ−UAM 141
142 ProteinShop                                     -4.07 -3.68 -4.21 -4.02 -3.61 -4.26                                     -7.14 -5.97 -6.02 -7.03 -5.84 -6.10 ProteinShop 142
143 RPFM                                     -4.07 -3.68 -4.21 -4.02 -3.61 -4.26                                     -7.14 -5.97 -6.02 -7.03 -5.84 -6.10 RPFM 143
144 SAINT1                                     -4.07 -3.68 -4.21 -4.02 -3.61 -4.26                                     -7.14 -5.97 -6.02 -7.03 -5.84 -6.10 SAINT1 144
145 ShakAbInitio                                     -4.07 -3.68 -4.21 -4.02 -3.61 -4.26                                     -7.14 -5.97 -6.02 -7.03 -5.84 -6.10 ShakAbInitio 145
146 TsaiLab                                     -4.07 -3.68 -4.21 -4.02 -3.61 -4.26                                     -7.14 -5.97 -6.02 -7.03 -5.84 -6.10 TsaiLab 146
147 UCDavisGenome                                     -4.07 -3.68 -4.21 -4.02 -3.61 -4.26                                     -7.14 -5.97 -6.02 -7.03 -5.84 -6.10 UCDavisGenome 147
148 Wolfson−FOBIA                                     -4.07 -3.68 -4.21 -4.02 -3.61 -4.26                                     -7.14 -5.97 -6.02 -7.03 -5.84 -6.10 Wolfson−FOBIA 148
149 Wolynes                                     -4.07 -3.68 -4.21 -4.02 -3.61 -4.26                                     -7.14 -5.97 -6.02 -7.03 -5.84 -6.10 Wolynes 149
150 YASARA                                     -4.07 -3.68 -4.21 -4.02 -3.61 -4.26                                     -7.14 -5.97 -6.02 -7.03 -5.84 -6.10 YASARA 150
151 YASARARefine                                     -4.07 -3.68 -4.21 -4.02 -3.61 -4.26                                     -7.14 -5.97 -6.02 -7.03 -5.84 -6.10 YASARARefine 151
152 dill_ucsf                                     -4.07 -3.68 -4.21 -4.02 -3.61 -4.26                                     -7.14 -5.97 -6.02 -7.03 -5.84 -6.10 dill_ucsf 152
153 dill_ucsf_extended                                     -4.07 -3.68 -4.21 -4.02 -3.61 -4.26                                     -7.14 -5.97 -6.02 -7.03 -5.84 -6.10 dill_ucsf_extended 153
154 huber−torda−server                                     -4.07 -3.68 -4.21 -4.02 -3.61 -4.26                                     -7.14 -5.97 -6.02 -7.03 -5.84 -6.10 huber−torda−server 154
155 igor                                     -4.07 -3.68 -4.21 -4.02 -3.61 -4.26                                     -7.14 -5.97 -6.02 -7.03 -5.84 -6.10 igor 155
156 jacobson                                     -4.07 -3.68 -4.21 -4.02 -3.61 -4.26                                     -7.14 -5.97 -6.02 -7.03 -5.84 -6.10 jacobson 156
157 keasar                                     -4.07 -3.68 -4.21 -4.02 -3.61 -4.26                                     -7.14 -5.97 -6.02 -7.03 -5.84 -6.10 keasar 157
158 mahmood−torda−server                                     -4.07 -3.68 -4.21 -4.02 -3.61 -4.26                                     -7.18 -6.00 -6.02 -7.22 -5.96 -6.10 mahmood−torda−server 158
159 mti                                     -4.07 -3.68 -4.21 -4.02 -3.61 -4.26                                     -7.14 -5.97 -6.02 -7.03 -5.84 -6.10 mti 159
160 mumssp                                     -4.07 -3.68 -4.21 -4.02 -3.61 -4.26                                     -7.14 -5.97 -6.02 -7.03 -5.84 -6.10 mumssp 160
161 ricardo                                     -4.07 -3.68 -4.21 -4.02 -3.61 -4.26                                     -7.14 -5.97 -6.02 -7.03 -5.84 -6.10 ricardo 161
162 rivilo                                     -4.07 -3.68 -4.21 -4.02 -3.61 -4.26                                     -7.14 -5.97 -6.02 -7.03 -5.84 -6.10 rivilo 162
163 sessions                                     -4.07 -3.68 -4.21 -4.02 -3.61 -4.26                                     -7.14 -5.97 -6.02 -7.03 -5.84 -6.10 sessions 163
164 taylor                                     -4.07 -3.68 -4.21 -4.02 -3.61 -4.26                                     -7.14 -5.97 -6.02 -7.03 -5.84 -6.10 taylor 164
165 test_http_server_01                                     -4.07 -3.68 -4.21 -4.02 -3.61 -4.26                                     -7.14 -5.97 -6.02 -7.03 -5.84 -6.10 test_http_server_01 165
166 tripos_08                                     -4.07 -3.68 -4.21 -4.02 -3.61 -4.26                                     -7.14 -5.97 -6.02 -7.03 -5.84 -6.10 tripos_08 166