T0495

Targets
387 388 389 390
391 392 393 394
395 396 397 398
399 400 401 402
403 404 405 406
407 408 409 410
411 412 413 414
415 416 417 418
419 420 421 422
423 424 425 426
427 428 429 430
431 432 433 434
435 436 437 438
439 440 441 442
443 444 445 446
447 448 449 450
451 452 453 454
455 456 457 458
459 460 461 462
463 464 465 466
467 468 469 470
471 472 473 474
475 476 477 478
479 480 481 482
483 484 485 486
487 488 489 490
491 492 493 494
495 496 497 498
499 500 501 502
503 504 505 506
507 508 509 510
511 512 513 514

T0495

SPO1766 endonuclease from Silicibacter pomeroyi

Target type: Human/Server

Target sequence:

>T0495 SPO1766 protein of unknown function, Silicibacter pomeroyi, 150 residues
MPMTLDLQPGQRLARGVARHLRAHGFVSVEEFVPARGLRVDVMGLGPKGEIWVIECKSSRADFQADAKWQGYLEWCDRYFWAVDMEFPAELLPAESGLLIADAYDAEIVRMAPEQKLAPARRKVLIQKFATHAARRLQALRDPEGHGIFE

Structure:
Method: X-ray, res=1.94Å, R/Rfree=0.17/0.21
Determined by: MCSG
PDB ID: 3dnx

3dnx cartoon
Cartoon diagram of 495: 3dnx

PyMOL of 3dnx

Domains:  PyMOL of domains

Single domain protein.

Structure classification:

Restriction Endonuclease fold.

3dnx cartoon
Ribbon diagram of 495: 3dnx

CASP category:

Fold recognition. C-terminal part has a different structure (additional β/α-unit, and an α-helix on the opposite side of the molecule) compared to the closest template.

Closest templates:

1y88, 1gef, 1ob8, 1hh1, 2eo0.

Target sequence - PDB file inconsistencies:

T0495    3dnx.pdb    T0495.pdb    PyMOL    PyMOL of domains    

T0495    1 MPMTLDLQPGQRLARGVARHLRAHGFVSVEEFVPARGLRVDVMGLGPKGEIWVIECKSSRADFQADAKWQGYLEWCDRYFWAVDMEFPAELLPAESGLLIADAYDAEIVRMAPEQKLAPARRKVLIQKFATHAARRLQALRDPEGHGIFE 150
           ~~~~||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3dnxA    5 ----LDLQPGQRLARGVARHLRAHGFVSVEEFVPARGLRVDVMGLGPKGEIWVIECKSSRADFQADAKWQGYLEWCDRYFWAVDMEFPAELLPAESGLLIADAYDAEIVRMAPEQKLAPARRKVLIQKFATHAARRLQALRDPEGHGIFE 150

Residue change log: change 43, 85, 111, MSE to MET;

Single domain protein: target 5-150 ; pdb 5-150

Sequence classification:

Protein of unknown function (DUF1052) in Pfam.

Server predictions:

T0495:pdb 5-150:seq 5-150:FR;   alignment

distribution of first scores
First models for T0495: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

# GROUP ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ ↓ GROUP #
T0495 T0495 T0495 T0495
First score First Z-score Best score Best Z-score
1 SAM−T08−human 47.95 36.76 52.56 2.36 1.53 1.80 47.95 36.76 52.56 2.18 1.18 1.35 SAM−T08−human 1
2 DBAKER 44.01 39.90 51.32 1.74 2.11 1.63 44.01 39.90 51.32 1.50 1.80 1.20 DBAKER 2
3 MULTICOM 43.49 34.82 57.12 1.66 1.17 2.41 43.49 34.82 57.12 1.41 0.79 1.93 MULTICOM 3
4 HHpred4 42.12 34.59 46.18 1.44 1.13 0.95 42.12 34.59 46.18 1.18 0.75 0.56 HHpred4 4
5 3D−JIGSAW_AEP 41.44 34.48 43.24 1.34 1.11 0.56 41.78 37.10 44.50 1.12 1.24 0.34 3D−JIGSAW_AEP 5
6 SAM−T08−server 40.92 32.93 46.55 1.26 0.83 1.00 40.92 32.93 48.28 0.97 0.42 0.82 SAM−T08−server 6
7 3DShot1 40.58 34.53 45.23 1.20 1.12 0.82 40.58 34.53 45.23 0.91 0.74 0.44 3DShot1 7
8 IBT_LT 40.24 37.84 45.09 1.15 1.73 0.80 40.24 37.84 45.09 0.86 1.39 0.42 IBT_LT 8
9 FAMS−multi 39.73 37.67 45.92 1.07 1.70 0.91 39.73 37.67 45.92 0.77 1.36 0.52 FAMS−multi 9
10 MULTICOM−CLUSTER 39.73 35.05 41.67 1.07 1.22 0.35 40.41 35.27 43.55 0.88 0.88 0.23 MULTICOM−CLUSTER 10
11 MULTICOM−CMFR 39.73 34.59 41.67 1.07 1.13 0.35 39.73 34.59 43.20 0.77 0.75 0.18 MULTICOM−CMFR 11
12 GS−KudlatyPred 39.38 36.30 51.05 1.01 1.45 1.60 39.38 36.30 51.05 0.71 1.09 1.17 GS−KudlatyPred 12
13 GeneSilico 39.38 34.59 42.74 1.01 1.13 0.49 39.90 34.59 42.74 0.80 0.75 0.12 GeneSilico 13
14 3Dpro 39.21 34.19 47.34 0.99 1.06 1.10 40.41 35.73 48.95 0.88 0.97 0.90 3Dpro 14
15 RAPTOR 39.21 33.51 51.47 0.99 0.93 1.65 39.21 37.61 51.47 0.68 1.35 1.22 RAPTOR 15
16 Zhang−Server 39.21 30.65 53.47 0.99 0.41 1.92 43.84 37.90 57.53 1.47 1.40 1.98 Zhang−Server 16
17 McGuffin 39.21 30.65 53.47 0.99 0.41 1.92 39.73 33.56 53.47 0.77 0.54 1.47 McGuffin 17
18 MUProt 38.87 34.87 40.24 0.93 1.18 0.16 38.87 34.87 43.67 0.62 0.80 0.24 MUProt 18
19 MULTICOM−RANK 38.87 34.08 39.98 0.93 1.04 0.12 40.58 35.45 42.14 0.91 0.92 0.05 MULTICOM−RANK 19
20 mufold 38.87 28.54 51.80 0.93 0.02 1.70 42.64 34.53 55.13 1.27 0.74 1.68 mufold 20
21 Elofsson 38.70 34.59 40.32 0.91 1.13 0.17 39.55 35.56 41.79 0.74 0.94 0.01 Elofsson 21
22 nFOLD3 38.70 34.36 35.22 0.91 1.09 -0.51 39.55 35.45 35.22 0.74 0.92 -0.82 nFOLD3 22
23 fams−ace2 38.70 32.88 52.64 0.91 0.82 1.81 38.70 34.25 52.64 0.59 0.68 1.36 fams−ace2 23
24 MULTICOM−REFINE 38.36 34.25 40.28 0.85 1.07 0.16 39.21 34.42 41.16 0.68 0.71 -0.07 MULTICOM−REFINE 24
25 SAMUDRALA 38.36 31.85 50.50 0.85 0.63 1.53 43.32 36.47 56.00 1.38 1.12 1.79 SAMUDRALA 25
26 Pcons_dot_net 38.36 29.45 38.05 0.85 0.18 -0.13 40.07 32.59 43.62 0.83 0.35 0.23 Pcons_dot_net 26
27 HHpred5 38.01 35.50 45.86 0.80 1.30 0.91 38.01 35.50 45.86 0.47 0.93 0.52 HHpred5 27
28 Zhang 38.01 31.05 54.28 0.80 0.48 2.03 42.64 36.02 56.78 1.27 1.03 1.88 Zhang 28
29 Hao_Kihara 38.01 28.71 36.64 0.80 0.05 -0.32 38.36 34.25 38.66 0.53 0.68 -0.39 Hao_Kihara 29
30 circle 37.67 33.45 41.57 0.75 0.92 0.33 39.21 34.65 45.08 0.68 0.76 0.42 circle 30
31 HHpred2 37.67 33.22 34.81 0.75 0.88 -0.57 37.67 33.22 34.81 0.41 0.48 -0.87 HHpred2 31
32 FEIG 37.50 32.36 43.19 0.72 0.72 0.55 38.19 33.96 43.19 0.50 0.62 0.18 FEIG 32
33 LevittGroup 37.50 30.88 43.14 0.72 0.45 0.54 38.36 33.68 43.15 0.53 0.57 0.18 LevittGroup 33
34 TASSER 37.33 33.22 51.57 0.69 0.88 1.67 38.87 33.22 51.57 0.62 0.48 1.23 TASSER 34
35 3DShot2 37.33 32.88 38.85 0.69 0.82 -0.03 37.33 32.88 38.85 0.36 0.41 -0.36 3DShot2 35
36 CpHModels 37.33 31.05 25.89 0.69 0.48 -1.76 37.33 31.05 25.89 0.36 0.05 -1.99 CpHModels 36
37 ACOMPMOD 37.16 31.45 39.43 0.67 0.55 0.05 37.16 31.45 39.43 0.33 0.13 -0.29 ACOMPMOD 37
38 MidwayFolding 36.99 30.71 41.64 0.64 0.42 0.34 39.21 33.51 51.47 0.68 0.53 1.22 MidwayFolding 38
39 AMU−Biology 36.64 32.19 38.63 0.58 0.69 -0.06 36.64 32.48 39.07 0.24 0.33 -0.34 AMU−Biology 39
40 Bates_BMM 36.47 32.02 38.73 0.56 0.66 -0.04 38.01 33.45 44.60 0.47 0.52 0.36 Bates_BMM 40
41 FAMSD 36.13 30.88 44.13 0.50 0.45 0.68 39.04 36.07 44.13 0.65 1.04 0.30 FAMSD 41
42 Chicken_George 36.13 30.36 45.73 0.50 0.35 0.89 39.90 32.48 52.96 0.80 0.33 1.40 Chicken_George 42
43 pro−sp3−TASSER 36.13 29.85 48.62 0.50 0.26 1.27 38.53 34.30 48.62 0.56 0.69 0.86 pro−sp3−TASSER 43
44 Frankenstein 36.13 29.17 39.99 0.50 0.13 0.12 36.64 32.65 39.99 0.24 0.36 -0.22 Frankenstein 44
45 Jones−UCL 35.79 32.19 48.67 0.45 0.69 1.28 43.49 37.10 52.74 1.41 1.24 1.38 Jones−UCL 45
46 PS2−server 35.79 31.45 37.62 0.45 0.55 -0.19 35.79 32.65 41.98 0.09 0.36 0.03 PS2−server 46
47 PS2−manual 35.79 31.45 37.62 0.45 0.55 -0.19 35.79 32.65 41.98 0.09 0.36 0.03 PS2−manual 47
48 Phyre_de_novo 35.62 33.45 39.49 0.42 0.92 0.06 40.24 37.73 49.99 0.86 1.37 1.03 Phyre_de_novo 48
49 A−TASSER 35.62 30.48 46.87 0.42 0.37 1.04 37.16 32.36 46.87 0.33 0.31 0.64 A−TASSER 49
50 LEE 35.62 29.80 46.58 0.42 0.25 1.00 36.30 31.73 46.58 0.18 0.18 0.61 LEE 50
51 SMEG−CCP 35.62 29.80 42.37 0.42 0.25 0.44 35.62 29.80 42.37 0.06 -0.20 0.08 SMEG−CCP 51
52 FUGUE_KM 35.62 28.65 29.03 0.42 0.04 -1.34 35.62 31.68 29.03 0.06 0.17 -1.59 FUGUE_KM 52
53 FFASsuboptimal 35.45 31.56 31.94 0.40 0.57 -0.95 35.45 31.56 31.94 0.03 0.15 -1.23 FFASsuboptimal 53
54 METATASSER 35.45 31.34 39.40 0.40 0.53 0.05 36.47 31.34 44.12 0.21 0.10 0.30 METATASSER 54
55 FrankensteinLong 35.45 30.42 39.83 0.40 0.36 0.10 35.45 30.71 39.83 0.03 -0.02 -0.24 FrankensteinLong 55
56 BAKER−ROBETTA 35.27 31.73 43.62 0.37 0.60 0.61 38.53 33.96 50.61 0.56 0.62 1.11 BAKER−ROBETTA 56
57 MUSTER 35.27 30.48 34.57 0.37 0.37 -0.60 39.55 34.48 42.26 0.74 0.73 0.06 MUSTER 57
58 ricardo 35.10 31.11 36.73 0.34 0.49 -0.31 35.10 31.28 36.80 -0.03 0.09 -0.62 ricardo 58
59 EB_AMU_Physics 34.93 31.85 33.05 0.31 0.63 -0.80 34.93 31.85 33.05 -0.05 0.21 -1.09 EB_AMU_Physics 59
60 Sternberg 34.93 29.91 42.09 0.31 0.27 0.40 39.21 34.02 53.47 0.68 0.63 1.47 Sternberg 60
61 Pcons_multi 34.93 29.91 42.09 0.31 0.27 0.40 41.61 33.62 43.17 1.09 0.56 0.18 Pcons_multi 61
62 pipe_int 34.59 30.48 37.18 0.26 0.37 -0.25 34.59 30.48 37.18 -0.11 -0.07 -0.57 pipe_int 62
63 ABIpro 34.42 22.89 41.61 0.23 -1.02 0.34 34.42 30.82 41.61 -0.14 0.00 -0.02 ABIpro 63
64 keasar−server 34.25 26.83 40.64 0.21 -0.30 0.21 41.78 34.59 43.80 1.12 0.75 0.26 keasar−server 64
65 Phyre2 34.08 31.22 35.65 0.18 0.51 -0.45 34.42 31.22 39.03 -0.14 0.08 -0.34 Phyre2 65
66 FOLDpro 34.08 29.74 32.27 0.18 0.24 -0.90 40.75 35.62 42.62 0.94 0.95 0.11 FOLDpro 66
67 Kolinski 33.90 29.80 40.11 0.15 0.25 0.14 36.13 33.45 44.20 0.15 0.52 0.31 Kolinski 67
68 SAINT1 33.73 30.19 41.14 0.13 0.32 0.28 33.73 30.19 41.14 -0.26 -0.12 -0.08 SAINT1 68
69 PSI 33.56 30.71 47.80 0.10 0.42 1.17 33.90 31.22 47.80 -0.23 0.08 0.76 PSI 69
70 Jiang_Zhu 33.56 30.48 35.92 0.10 0.37 -0.42 38.01 35.62 43.03 0.47 0.95 0.16 Jiang_Zhu 70
71 mGenTHREADER 33.56 27.63 26.67 0.10 -0.15 -1.65 33.56 27.63 26.67 -0.29 -0.63 -1.89 mGenTHREADER 71
72 COMA 33.39 28.94 36.90 0.07 0.09 -0.29 33.39 28.94 36.90 -0.32 -0.37 -0.61 COMA 72
73 3DShotMQ 33.39 24.26 37.78 0.07 -0.77 -0.17 33.39 24.26 37.78 -0.32 -1.30 -0.50 3DShotMQ 73
74 GS−MetaServer2 32.88 31.28 29.00 -0.01 0.52 -1.34 35.62 31.28 34.22 0.06 0.09 -0.94 GS−MetaServer2 74
75 GeneSilicoMetaServer 32.88 31.28 29.00 -0.01 0.52 -1.34 35.62 31.28 34.22 0.06 0.09 -0.94 GeneSilicoMetaServer 75
76 COMA−M 32.88 30.14 35.19 -0.01 0.31 -0.52 32.88 30.14 35.19 -0.41 -0.13 -0.82 COMA−M 76
77 KudlatyPredHuman 32.53 28.65 44.04 -0.06 0.04 0.66 42.81 34.82 55.40 1.30 0.79 1.71 KudlatyPredHuman 77
78 fleil 32.19 29.22 33.90 -0.12 0.14 -0.69 32.19 29.39 33.90 -0.52 -0.28 -0.98 fleil 78
79 StruPPi 30.99 26.88 35.10 -0.30 -0.29 -0.53 30.99 26.88 35.10 -0.73 -0.78 -0.83 StruPPi 79
80 Pcons_local 30.65 27.68 14.47 -0.36 -0.14 -3.28 32.70 29.34 14.92 -0.44 -0.29 -3.36 Pcons_local 80
81 LOOPP_Server 29.97 22.32 26.21 -0.46 -1.13 -1.71 29.97 22.32 27.12 -0.90 -1.68 -1.83 LOOPP_Server 81
82 SAM−T06−server 29.80 27.17 27.87 -0.49 -0.24 -1.49 34.93 31.51 27.87 -0.05 0.14 -1.74 SAM−T06−server 82
83 Softberry 29.62 27.91 33.46 -0.52 -0.10 -0.75 29.62 27.91 33.46 -0.96 -0.57 -1.04 Softberry 83
84 Distill 29.11 23.06 37.54 -0.60 -0.99 -0.20 32.19 24.32 38.84 -0.52 -1.29 -0.36 Distill 84
85 FFASflextemplate 28.43 26.83 10.73 -0.71 -0.30 -3.78 28.43 26.83 10.73 -1.17 -0.79 -3.89 FFASflextemplate 85
86 keasar 28.25 21.57 38.77 -0.74 -1.27 -0.04 39.73 36.87 52.06 0.77 1.20 1.29 keasar 86
87 ZicoFullSTPFullData 27.91 22.15 39.22 -0.79 -1.16 0.02 38.53 32.48 50.94 0.56 0.33 1.15 ZicoFullSTPFullData 87
88 FFASstandard 27.57 26.20 10.27 -0.84 -0.41 -3.84 28.43 26.83 10.73 -1.17 -0.79 -3.89 FFASstandard 88
89 FALCON_CONSENSUS 27.23 24.71 43.68 -0.90 -0.69 0.62 27.23 24.71 44.23 -1.37 -1.21 0.31 FALCON_CONSENSUS 89
90 FALCON 27.23 24.71 43.68 -0.90 -0.69 0.62 27.23 24.71 45.22 -1.37 -1.21 0.43 FALCON 90
91 POEMQA 27.23 22.03 39.01 -0.90 -1.18 -0.01 35.62 29.68 47.34 0.06 -0.22 0.70 POEMQA 91
92 SAM−T02−server 27.05 26.48 8.14 -0.92 -0.36 -4.12 27.05 26.48 8.14 -1.40 -0.86 -4.21 SAM−T02−server 92
93 Sasaki−Cetin−Sasai 26.71 24.66 44.12 -0.98 -0.70 0.67 27.05 26.37 45.60 -1.40 -0.88 0.48 Sasaki−Cetin−Sasai 93
94 BioSerf 26.54 24.54 42.08 -1.00 -0.72 0.40 26.54 24.54 42.08 -1.49 -1.24 0.04 BioSerf 94
95 RBO−Proteus 26.54 20.49 38.59 -1.00 -1.47 -0.06 27.91 23.06 39.44 -1.26 -1.53 -0.29 RBO−Proteus 95
96 PRI−Yang−KiharA 26.03 20.72 40.18 -1.08 -1.42 0.15 26.03 20.72 40.18 -1.58 -2.00 -0.20 PRI−Yang−KiharA 96
97 igor 25.17 23.23 21.86 -1.22 -0.96 -2.29 25.17 23.23 21.86 -1.73 -1.50 -2.49 igor 97
98 Zico 24.49 18.55 36.86 -1.33 -1.82 -0.29 38.53 29.97 50.94 0.56 -0.17 1.15 Zico 98
99 ZicoFullSTP 24.49 18.55 36.86 -1.33 -1.82 -0.29 38.53 32.48 50.94 0.56 0.33 1.15 ZicoFullSTP 99
100 Bilab−UT 23.97 22.43 41.32 -1.41 -1.11 0.30 35.79 33.16 44.15 0.09 0.46 0.30 Bilab−UT 100
101 xianmingpan 22.77 19.86 26.41 -1.60 -1.58 -1.69 22.77 20.03 26.41 -2.14 -2.13 -1.92 xianmingpan 101
102 Handl−Lovell 22.43 21.63 40.90 -1.65 -1.26 0.25 25.00 21.63 40.90 -1.76 -1.82 -0.11 Handl−Lovell 102
103 TJ_Jiang 22.43 18.78 36.20 -1.65 -1.78 -0.38 25.68 21.00 40.95 -1.64 -1.94 -0.10 TJ_Jiang 103
104 FLOUDAS 21.75 17.98 41.69 -1.76 -1.93 0.35 28.60 22.32 42.07 -1.14 -1.68 0.04 FLOUDAS 104
105 MUFOLD−MD 21.57 21.18 37.70 -1.78 -1.34 -0.18 23.12 21.18 42.19 -2.08 -1.91 0.06 MUFOLD−MD 105
106 taylor 21.57 17.81 29.22 -1.78 -1.96 -1.31 27.23 25.80 37.46 -1.37 -0.99 -0.54 taylor 106
107 MeilerLabRene 20.89 20.15 31.55 -1.89 -1.53 -1.00 22.60 21.69 32.30 -2.17 -1.81 -1.18 MeilerLabRene 107
108 Phragment 20.72 20.43 29.89 -1.92 -1.48 -1.22 22.26 21.80 30.58 -2.23 -1.78 -1.40 Phragment 108
109 MUFOLD−Server 20.55 17.47 26.76 -1.95 -2.02 -1.64 20.72 19.18 27.07 -2.49 -2.30 -1.84 MUFOLD−Server 109
110 Wolynes 20.38 19.23 30.82 -1.97 -1.70 -1.10 24.14 19.75 33.45 -1.90 -2.19 -1.04 Wolynes 110
111 fais−server 20.38 17.92 37.88 -1.97 -1.94 -0.16 21.06 19.81 41.12 -2.43 -2.18 -0.08 fais−server 111
112 POEM 19.86 18.78 35.02 -2.05 -1.78 -0.54 23.97 21.98 47.34 -1.93 -1.75 0.70 POEM 112
113 forecast 19.69 17.86 24.81 -2.08 -1.95 -1.90 24.66 19.12 30.61 -1.81 -2.31 -1.40 forecast 113
114 Scheraga 19.69 17.75 29.27 -2.08 -1.97 -1.30 19.69 17.75 32.56 -2.67 -2.59 -1.15 Scheraga 114
115 DistillSN 18.49 17.18 23.70 -2.27 -2.07 -2.05 20.20 18.27 24.06 -2.58 -2.48 -2.22 DistillSN 115
116 POISE 18.15 16.72 31.02 -2.32 -2.16 -1.07 22.43 19.86 35.66 -2.20 -2.17 -0.76 POISE 116
117 Poing 17.12 14.55 32.48 -2.48 -2.56 -0.88 21.06 17.41 37.49 -2.43 -2.65 -0.53 Poing 117
118 mariner1 17.12 13.13 21.22 -2.48 -2.82 -2.38 32.70 27.91 29.65 -0.44 -0.57 -1.52 mariner1 118
119 huber−torda−server 16.61 16.27 22.56 -2.56 -2.24 -2.20 31.34 24.71 22.56 -0.67 -1.21 -2.40 huber−torda−server 119
120 RANDOM 16.18 13.91 16.18 -2.63 -2.68 -3.05 16.18 13.91 16.18 -3.27 -3.35 -3.20 RANDOM 120
121 DelCLab 15.24 14.95 19.09 -2.78 -2.49 -2.66 17.12 15.58 20.10 -3.11 -3.02 -2.71 DelCLab 121
122 3D−JIGSAW_V3 15.24 13.19 13.97 -2.78 -2.81 -3.34 15.24 13.19 15.92 -3.43 -3.49 -3.24 3D−JIGSAW_V3 122
123 NIM2 14.73 13.36 16.61 -2.86 -2.78 -2.99 14.73 13.36 16.61 -3.52 -3.45 -3.15 NIM2 123
124 TWPPLAB 13.70 12.27 11.96 -3.02 -2.98 -3.61 13.70 12.27 11.96 -3.69 -3.67 -3.73 TWPPLAB 124
125 schenk−torda−server 13.19 9.99 13.87 -3.10 -3.40 -3.36 13.87 12.67 19.12 -3.66 -3.59 -2.84 schenk−torda−server 125
126 mahmood−torda−server 12.16 10.10 18.94 -3.26 -3.38 -2.68 15.93 12.50 20.92 -3.31 -3.62 -2.61 mahmood−torda−server 126
127 OLGAFS 10.96 10.10 -3.74 -3.45 -3.38 -5.71 11.30 10.56 -2.90 -4.10 -4.01 -5.59 OLGAFS 127
128 rehtnap 10.27 9.70 -12.83 -3.56 -3.45 -6.92 10.27 9.70 -12.83 -4.28 -4.18 -6.84 rehtnap 128
129 panther_server 7.19 6.85 -15.28 -4.04 -3.98 -7.24 18.84 16.32 5.46 -2.81 -2.87 -4.55 panther_server 129
130 Abagyan                   -2.63 -2.68 -3.05                   -3.27 -3.35 -3.20 Abagyan 130
131 BHAGEERATH                   -2.63 -2.68 -3.05                   -3.27 -3.35 -3.20 BHAGEERATH 131
132 CBSU                   -2.63 -2.68 -3.05                   -3.27 -3.35 -3.20 CBSU 132
133 FEIG_REFINE                   -2.63 -2.68 -3.05                   -3.27 -3.35 -3.20 FEIG_REFINE 133
134 Fiser−M4T                   -2.63 -2.68 -3.05                   -3.27 -3.35 -3.20 Fiser−M4T 134
135 HCA                   -2.63 -2.68 -3.05                   -3.27 -3.35 -3.20 HCA 135
136 JIVE08                   -2.63 -2.68 -3.05                   -3.27 -3.35 -3.20 JIVE08 136
137 LEE−SERVER                   -2.63 -2.68 -3.05                   -3.27 -3.35 -3.20 LEE−SERVER 137
138 Linnolt−UH−CMB                   -2.63 -2.68 -3.05                   -3.27 -3.35 -3.20 Linnolt−UH−CMB 138
139 Nano_team                   -2.63 -2.68 -3.05                   -3.27 -3.35 -3.20 Nano_team 139
140 NirBenTal                   -2.63 -2.68 -3.05                   -3.27 -3.35 -3.20 NirBenTal 140
141 Ozkan−Shell                   -2.63 -2.68 -3.05                   -3.27 -3.35 -3.20 Ozkan−Shell 141
142 PHAISTOS                   -2.63 -2.68 -3.05                   -3.27 -3.35 -3.20 PHAISTOS 142
143 PZ−UAM                   -2.63 -2.68 -3.05                   -3.27 -3.35 -3.20 PZ−UAM 143
144 ProtAnG                   -2.63 -2.68 -3.05                   -3.27 -3.35 -3.20 ProtAnG 144
145 ProteinShop                   -2.63 -2.68 -3.05                   -3.27 -3.35 -3.20 ProteinShop 145
146 Pushchino                   -2.63 -2.68 -3.05                   -3.27 -3.35 -3.20 Pushchino 146
147 RPFM                   -2.63 -2.68 -3.05                   -3.27 -3.35 -3.20 RPFM 147
148 SHORTLE                   -2.63 -2.68 -3.05                   -3.27 -3.35 -3.20 SHORTLE 148
149 ShakAbInitio                   -2.63 -2.68 -3.05                   -3.27 -3.35 -3.20 ShakAbInitio 149
150 TsaiLab                   -2.63 -2.68 -3.05                   -3.27 -3.35 -3.20 TsaiLab 150
151 UCDavisGenome                   -2.63 -2.68 -3.05                   -3.27 -3.35 -3.20 UCDavisGenome 151
152 Wolfson−FOBIA                   -2.63 -2.68 -3.05                   -3.27 -3.35 -3.20 Wolfson−FOBIA 152
153 YASARA                   -2.63 -2.68 -3.05                   -3.27 -3.35 -3.20 YASARA 153
154 YASARARefine                   -2.63 -2.68 -3.05                   -3.27 -3.35 -3.20 YASARARefine 154
155 Zhou−SPARKS                   -2.63 -2.68 -3.05                   -3.27 -3.35 -3.20 Zhou−SPARKS 155
156 dill_ucsf                   -2.63 -2.68 -3.05                   -3.27 -3.35 -3.20 dill_ucsf 156
157 dill_ucsf_extended                   -2.63 -2.68 -3.05                   -3.27 -3.35 -3.20 dill_ucsf_extended 157
158 fais@hgc                   -2.63 -2.68 -3.05                   -3.27 -3.35 -3.20 fais@hgc 158
159 jacobson                   -2.63 -2.68 -3.05                   -3.27 -3.35 -3.20 jacobson 159
160 mti                   -2.63 -2.68 -3.05                   -3.27 -3.35 -3.20 mti 160
161 mumssp                   -2.63 -2.68 -3.05                   -3.27 -3.35 -3.20 mumssp 161
162 psiphifoldings                   -2.63 -2.68 -3.05                   -3.27 -3.35 -3.20 psiphifoldings 162
163 rivilo                   -2.63 -2.68 -3.05                   -3.27 -3.35 -3.20 rivilo 163
164 sessions                   -2.63 -2.68 -3.05                   -3.27 -3.35 -3.20 sessions 164
165 test_http_server_01                   -2.63 -2.68 -3.05                   -3.27 -3.35 -3.20 test_http_server_01 165
166 tripos_08                   -2.63 -2.68 -3.05                   -3.27 -3.35 -3.20 tripos_08 166