T0498

artificial protein L1c expressed in Escherichia coli

Target type: Human/Server

Target sequence:

>T0498 L1c, E coli, 56 residues
TTYKLILNLKQAKEEAIKELVDAGTAEKYIKLIANAKTVEGVWTLKDEIKTFTVTE

Structure:

Method: NMR

Determined by: Bryan & Orban

PDB ID: 2jws
(not the target, but close)

jumping through 498 NMR models
Jumping through 20 NMR models of

all 20 498 NMR models
All 20 superimposed NMR models of

PyMOL of 2jws

Domains: PyMOL of domains

Single domain protein with poorly structured termini. Structurally variable regions were removed from NMR models for evaluation of predictions.

Structure classification:

Left-handed three-helical bundle: Immunoglobulin-binding domain of protein A

2jws_1 cartoon
Cartoon diagram of 498: model 1 residues 6-54

CASP category:

Comparative modeling:hard:a very difficult target as the sequence is highly similar to Immunoglobulin-binding domains of proteins G and L: 1pgx , but the fold is different.

Closest templates:

Good resolution X-ray structures of protein A, e.g. 2j5y

Target sequence - PDB file inconsistencies:

T0498 2jws.pdb T0498.pdb PyMOL PyMOL of domains

T0498    1 TTYKLILNLKQAKEEAIKELVDAGTAEKYIKLIANAKTVEGVWTLKDEIKTFTVTE 56
           ******||||||||||||||||||:||||||||||||||||||||||||:||||**
2jwsA    1 TTYKLILNLKQAKEEAIKELVDAGIAEKYIKLIANAKTVEGVWTLKDEILTFTVTE 56

Residue change log: change 25 I to T; change 50 L to K; remove 1-TTYKLI-6, 55-TE-56 by 3.5Å SD cutoff;

Single domain protein: target 7-54 ; pdb 7-54

Sequence classification:

N/A for artifical designed protein.

Comments:

This artificial protein sequence is very similar to T0499 (just 3 amino acids differ), but was designed to have a drastically different fold 1).

T0498 TTYKLILNLKQAKEEAIKELVDAGTAEKYIKLIANAKTVEGVWTLKDEIKTFTVTE

T0499 TTYKLILNLKQAKEEAIKEAVDAGTAEKYFKLIANAKTVEGVWTYKDEIKTFTVTE

1pgx TTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE

1zxg MYYLVVNKQQNAFYEVLNMPNLNEDQRNAFIQSLKDDPSQSANVLAEAQKLNDVQA

1zxh MYYLVVNKGQNAFYETLTKAVDAETARNAFIQSLKDDGVQGVWTYDDATKTFTVQA

Server predictions:

T0498:pdb 7-54:seq 7-54:CM_hard; alignment

distribution of
first scores
First models for T0498: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

#	GROUP ↓	TS ↓	TR ↓	CS ↓	TS ↓	TR ↓	CS ↓	TS ↓	TR ↓	CS ↓	TS ↓	TR ↓	CS ↓	↓ GROUP	#
		T0498			T0498			T0498			T0498
		First score			First Z-score			Best score			Best Z-score
1	FEIG	85.42	78.47	81.39	4.23	3.82	4.05	85.42	78.47	81.39	3.60	3.29	3.40	FEIG	1
2	HHpred5	84.90	84.20	84.76	4.18	4.33	4.31	84.90	84.20	84.76	3.56	3.75	3.62	HHpred5	2
3	DBAKER	83.85	82.47	80.34	4.08	4.18	3.97	83.85	82.47	82.63	3.48	3.61	3.48	DBAKER	3
4	HHpred4	83.85	81.08	80.54	4.08	4.05	3.99	83.85	81.08	80.54	3.48	3.50	3.34	HHpred4	4
5	IBT_LT	83.33	83.33	81.14	4.04	4.25	4.03	83.33	83.33	81.14	3.43	3.68	3.38	IBT_LT	5
6	Softberry	82.29	81.60	78.44	3.94	4.10	3.83	82.29	81.60	78.44	3.35	3.54	3.20	Softberry	6
7	FOLDpro	76.56	74.48	69.76	3.41	3.47	3.18	82.81	82.12	80.39	3.39	3.58	3.33	FOLDpro	7
8	MidwayFolding	73.44	67.53	62.96	3.12	2.86	2.67	73.44	67.53	62.96	2.62	2.41	2.19	MidwayFolding	8
9	Bilab−UT	43.75	35.76	44.46	0.37	0.05	1.29	43.75	36.28	44.46	0.19	-0.09	0.98	Bilab−UT	9
10	MeilerLabRene	42.71	37.15	44.50	0.27	0.18	1.29	57.81	56.42	59.59	1.34	1.52	1.97	MeilerLabRene	10
11	RANDOM	42.10	35.33	42.10	0.22	0.01	1.11	42.10	35.33	42.10	0.05	-0.16	0.82	RANDOM	11
12	schenk−torda−server	41.15	36.28	42.74	0.13	0.10	1.16	43.23	36.63	42.74	0.14	-0.06	0.86	schenk−torda−server	12
13	POEM	39.06	32.99	26.88	-0.07	-0.19	-0.03	39.06	34.55	28.07	-0.20	-0.23	-0.10	POEM	13
14	FALCON_CONSENSUS	38.02	35.24	24.82	-0.16	0.01	-0.19	38.54	35.24	25.26	-0.24	-0.17	-0.28	FALCON_CONSENSUS	14
15	Distill	38.02	34.55	23.78	-0.16	-0.05	-0.26	38.54	34.55	24.70	-0.24	-0.23	-0.32	Distill	15
16	POEMQA	38.02	33.68	26.67	-0.16	-0.13	-0.05	38.54	34.38	28.07	-0.24	-0.24	-0.10	POEMQA	16
17	ABIpro	37.50	33.33	26.16	-0.21	-0.16	-0.09	37.50	33.33	26.16	-0.33	-0.32	-0.22	ABIpro	17
18	Zhang−Server	37.50	33.16	22.75	-0.21	-0.18	-0.34	37.50	33.16	23.36	-0.33	-0.34	-0.40	Zhang−Server	18
19	LOOPP_Server	37.50	32.99	23.87	-0.21	-0.19	-0.26	37.50	35.07	26.50	-0.33	-0.19	-0.20	LOOPP_Server	19
20	mufold	37.50	32.81	22.25	-0.21	-0.21	-0.38	37.50	32.81	23.40	-0.33	-0.37	-0.40	mufold	20
21	Zico	37.50	32.47	23.43	-0.21	-0.24	-0.29	37.50	32.47	24.11	-0.33	-0.39	-0.36	Zico	21
22	ZicoFullSTP	37.50	32.47	23.43	-0.21	-0.24	-0.29	37.50	32.47	23.80	-0.33	-0.39	-0.38	ZicoFullSTP	22
23	ZicoFullSTPFullData	37.50	32.47	23.43	-0.21	-0.24	-0.29	37.50	32.47	23.80	-0.33	-0.39	-0.38	ZicoFullSTPFullData	23
24	CpHModels	37.50	32.29	28.53	-0.21	-0.25	0.09	37.50	32.29	28.53	-0.33	-0.41	-0.07	CpHModels	24
25	MULTICOM−RANK	37.50	32.12	23.47	-0.21	-0.27	-0.29	37.50	32.12	23.47	-0.33	-0.42	-0.40	MULTICOM−RANK	25
26	MULTICOM−CLUSTER	37.50	32.12	23.37	-0.21	-0.27	-0.30	37.50	32.47	23.67	-0.33	-0.39	-0.38	MULTICOM−CLUSTER	26
27	SAMUDRALA	37.50	32.12	23.34	-0.21	-0.27	-0.30	37.50	32.12	23.43	-0.33	-0.42	-0.40	SAMUDRALA	27
28	LEE	37.50	32.12	23.29	-0.21	-0.27	-0.30	37.50	32.47	23.65	-0.33	-0.39	-0.39	LEE	28
29	MUProt	37.50	32.12	23.64	-0.21	-0.27	-0.28	37.50	32.12	23.64	-0.33	-0.42	-0.39	MUProt	29
30	3DShotMQ	37.50	32.12	23.40	-0.21	-0.27	-0.29	37.50	32.12	23.40	-0.33	-0.42	-0.40	3DShotMQ	30
31	Wolfson−FOBIA	37.50	32.12	23.78	-0.21	-0.27	-0.26	37.50	32.12	23.78	-0.33	-0.42	-0.38	Wolfson−FOBIA	31
32	TJ_Jiang	37.50	31.77	22.95	-0.21	-0.30	-0.33	37.50	32.12	24.28	-0.33	-0.42	-0.34	TJ_Jiang	32
33	huber−torda−server	37.50	31.60	22.37	-0.21	-0.31	-0.37	38.54	34.03	23.39	-0.24	-0.27	-0.40	huber−torda−server	33
34	3Dpro	37.50	31.60	24.09	-0.21	-0.31	-0.24	37.50	32.47	24.09	-0.33	-0.39	-0.36	3Dpro	34
35	3DShot2	37.50	31.60	22.38	-0.21	-0.31	-0.37	37.50	31.60	22.38	-0.33	-0.46	-0.47	3DShot2	35
36	MUFOLD−MD	37.50	31.60	26.17	-0.21	-0.31	-0.09	37.50	34.20	26.17	-0.33	-0.26	-0.22	MUFOLD−MD	36
37	Sternberg	37.50	31.25	23.35	-0.21	-0.35	-0.30	37.50	31.25	23.35	-0.33	-0.49	-0.41	Sternberg	37
38	Phyre_de_novo	37.50	31.25	23.35	-0.21	-0.35	-0.30	37.50	33.51	23.35	-0.33	-0.31	-0.41	Phyre_de_novo	38
39	AMU−Biology	37.50	30.90	22.91	-0.21	-0.38	-0.33	37.50	31.94	24.13	-0.33	-0.44	-0.35	AMU−Biology	39
40	Zhang	37.50	30.21	23.80	-0.21	-0.44	-0.26	37.50	34.03	24.16	-0.33	-0.27	-0.35	Zhang	40
41	mahmood−torda−server	36.98	35.42	40.92	-0.26	0.02	1.02	41.15	35.42	40.92	-0.03	-0.16	0.75	mahmood−torda−server	41
42	HHpred2	36.98	35.24	21.70	-0.26	0.01	-0.42	36.98	35.24	21.70	-0.37	-0.17	-0.51	HHpred2	42
43	TASSER	36.98	35.07	22.66	-0.26	-0.01	-0.35	38.54	35.07	23.39	-0.24	-0.19	-0.40	TASSER	43
44	ACOMPMOD	36.98	34.20	23.52	-0.26	-0.09	-0.28	40.62	34.20	31.90	-0.07	-0.26	0.15	ACOMPMOD	44
45	DelCLab	36.98	34.03	22.28	-0.26	-0.10	-0.38	36.98	35.59	22.63	-0.37	-0.14	-0.45	DelCLab	45
46	LevittGroup	36.98	32.29	22.41	-0.26	-0.25	-0.37	37.50	32.99	22.77	-0.33	-0.35	-0.44	LevittGroup	46
47	FAMSD	36.98	32.29	22.43	-0.26	-0.25	-0.37	36.98	35.42	23.42	-0.37	-0.16	-0.40	FAMSD	47
48	MULTICOM	36.98	32.29	23.18	-0.26	-0.25	-0.31	37.50	32.47	23.39	-0.33	-0.39	-0.40	MULTICOM	48
49	mariner1	36.98	32.12	23.78	-0.26	-0.27	-0.26	36.98	34.72	25.99	-0.37	-0.21	-0.23	mariner1	49
50	SAM−T08−server	36.98	31.94	23.15	-0.26	-0.28	-0.31	36.98	32.81	23.55	-0.37	-0.37	-0.39	SAM−T08−server	50
51	Elofsson	36.98	31.94	23.39	-0.26	-0.28	-0.29	37.50	34.90	23.82	-0.33	-0.20	-0.37	Elofsson	51
52	xianmingpan	36.98	31.94	21.58	-0.26	-0.28	-0.43	36.98	31.94	21.58	-0.37	-0.44	-0.52	xianmingpan	52
53	Pcons_dot_net	36.98	31.94	22.94	-0.26	-0.28	-0.33	37.50	33.16	24.40	-0.33	-0.34	-0.34	Pcons_dot_net	53
54	BioSerf	36.98	31.94	22.87	-0.26	-0.28	-0.33	36.98	31.94	22.87	-0.37	-0.44	-0.44	BioSerf	54
55	forecast	36.98	31.94	22.89	-0.26	-0.28	-0.33	36.98	33.68	23.12	-0.37	-0.30	-0.42	forecast	55
56	keasar−server	36.98	31.77	23.99	-0.26	-0.30	-0.25	36.98	33.16	24.09	-0.37	-0.34	-0.36	keasar−server	56
57	PSI	36.98	31.77	21.77	-0.26	-0.30	-0.42	36.98	35.59	23.97	-0.37	-0.14	-0.36	PSI	57
58	FAMS−multi	36.98	31.60	22.27	-0.26	-0.31	-0.38	36.98	31.77	22.27	-0.37	-0.45	-0.48	FAMS−multi	58
59	fams−ace2	36.98	31.42	23.90	-0.26	-0.33	-0.26	38.02	33.51	23.90	-0.28	-0.31	-0.37	fams−ace2	59
60	BAKER−ROBETTA	36.98	31.42	24.84	-0.26	-0.33	-0.19	36.98	31.42	24.85	-0.37	-0.48	-0.31	BAKER−ROBETTA	60
61	SAM−T08−human	36.98	31.25	23.91	-0.26	-0.35	-0.26	37.50	31.60	23.91	-0.33	-0.46	-0.37	SAM−T08−human	61
62	Fiser−M4T	36.98	31.25	21.84	-0.26	-0.35	-0.41	36.98	31.25	21.84	-0.37	-0.49	-0.50	Fiser−M4T	62
63	pipe_int	36.98	30.38	22.44	-0.26	-0.42	-0.37	36.98	34.03	23.55	-0.37	-0.27	-0.39	pipe_int	63
64	pro−sp3−TASSER	36.98	30.38	22.44	-0.26	-0.42	-0.37	38.54	32.99	23.66	-0.24	-0.35	-0.38	pro−sp3−TASSER	64
65	FFASstandard	36.98	30.21	23.96	-0.26	-0.44	-0.25	36.98	33.33	25.44	-0.37	-0.32	-0.27	FFASstandard	65
66	Abagyan	36.98	30.21	22.47	-0.26	-0.44	-0.36	37.50	32.29	23.03	-0.33	-0.41	-0.43	Abagyan	66
67	Frankenstein	36.98	29.69	22.99	-0.26	-0.48	-0.32	37.50	32.12	24.01	-0.33	-0.42	-0.36	Frankenstein	67
68	FrankensteinLong	36.98	29.69	23.05	-0.26	-0.48	-0.32	37.50	32.12	24.13	-0.33	-0.42	-0.35	FrankensteinLong	68
69	MULTICOM−CMFR	36.98	29.34	23.48	-0.26	-0.51	-0.29	38.54	34.20	24.69	-0.24	-0.26	-0.32	MULTICOM−CMFR	69
70	MULTICOM−REFINE	36.98	29.34	23.48	-0.26	-0.51	-0.29	37.50	32.47	23.57	-0.33	-0.39	-0.39	MULTICOM−REFINE	70
71	GeneSilico	36.98	29.34	23.48	-0.26	-0.51	-0.29	38.54	35.07	23.57	-0.24	-0.19	-0.39	GeneSilico	71
72	GS−KudlatyPred	36.46	35.07	23.06	-0.31	-0.01	-0.32	36.46	35.07	23.06	-0.41	-0.19	-0.42	GS−KudlatyPred	72
73	Bates_BMM	36.46	35.07	22.73	-0.31	-0.01	-0.34	36.98	35.07	23.48	-0.37	-0.19	-0.40	Bates_BMM	73
74	RBO−Proteus	36.46	34.38	21.99	-0.31	-0.07	-0.40	36.46	34.38	22.52	-0.41	-0.24	-0.46	RBO−Proteus	74
75	FUGUE_KM	36.46	33.85	23.15	-0.31	-0.12	-0.31	37.50	33.85	30.03	-0.33	-0.28	0.03	FUGUE_KM	75
76	StruPPi	36.46	32.81	22.18	-0.31	-0.21	-0.38	37.50	32.81	26.02	-0.33	-0.37	-0.23	StruPPi	76
77	EB_AMU_Physics	36.46	32.47	24.16	-0.31	-0.24	-0.24	36.98	35.59	24.16	-0.37	-0.14	-0.35	EB_AMU_Physics	77
78	Pcons_multi	36.46	32.12	23.33	-0.31	-0.27	-0.30	37.50	32.99	23.87	-0.33	-0.35	-0.37	Pcons_multi	78
79	3DShot1	36.46	31.94	22.62	-0.31	-0.28	-0.35	36.46	31.94	22.62	-0.41	-0.44	-0.45	3DShot1	79
80	fleil	36.46	31.94	22.89	-0.31	-0.28	-0.33	36.46	31.94	23.07	-0.41	-0.44	-0.42	fleil	80
81	RAPTOR	36.46	31.77	22.99	-0.31	-0.30	-0.32	36.98	35.59	24.05	-0.37	-0.14	-0.36	RAPTOR	81
82	METATASSER	36.46	31.60	21.46	-0.31	-0.31	-0.44	38.54	33.33	21.89	-0.24	-0.32	-0.50	METATASSER	82
83	Hao_Kihara	36.46	31.60	21.78	-0.31	-0.31	-0.41	37.50	35.59	24.03	-0.33	-0.14	-0.36	Hao_Kihara	83
84	Kolinski	36.46	31.42	23.92	-0.31	-0.33	-0.25	36.46	31.60	23.92	-0.41	-0.46	-0.37	Kolinski	84
85	OLGAFS	36.46	31.42	22.11	-0.31	-0.33	-0.39	36.46	32.12	22.94	-0.41	-0.42	-0.43	OLGAFS	85
86	FFASflextemplate	36.46	31.42	23.04	-0.31	-0.33	-0.32	36.46	34.90	23.35	-0.41	-0.20	-0.41	FFASflextemplate	86
87	FFASsuboptimal	36.46	31.42	23.04	-0.31	-0.33	-0.32	36.46	33.68	24.04	-0.41	-0.30	-0.36	FFASsuboptimal	87
88	tripos_08	36.46	31.42	24.77	-0.31	-0.33	-0.19	36.98	34.38	24.77	-0.37	-0.24	-0.31	tripos_08	88
89	MUFOLD−Server	36.46	31.25	22.06	-0.31	-0.35	-0.39	36.98	31.25	22.44	-0.37	-0.49	-0.46	MUFOLD−Server	89
90	McGuffin	36.46	31.25	22.06	-0.31	-0.35	-0.39	37.50	32.12	23.91	-0.33	-0.42	-0.37	McGuffin	90
91	NIM2	36.46	31.08	22.70	-0.31	-0.36	-0.35	36.46	31.08	22.70	-0.41	-0.50	-0.45	NIM2	91
92	Chicken_George	36.46	31.08	22.57	-0.31	-0.36	-0.36	79.69	73.78	74.80	3.13	2.91	2.96	Chicken_George	92
93	GeneSilicoMetaServer	36.46	30.73	23.02	-0.31	-0.39	-0.32	37.50	31.25	23.98	-0.33	-0.49	-0.36	GeneSilicoMetaServer	93
94	GS−MetaServer2	36.46	30.38	22.12	-0.31	-0.42	-0.39	36.46	35.42	23.95	-0.41	-0.16	-0.37	GS−MetaServer2	94
95	MUSTER	36.46	30.38	23.51	-0.31	-0.42	-0.29	38.02	34.90	26.16	-0.28	-0.20	-0.22	MUSTER	95
96	FALCON	36.46	30.21	22.76	-0.31	-0.44	-0.34	39.58	31.77	26.00	-0.16	-0.45	-0.23	FALCON	96
97	circle	36.46	27.60	23.80	-0.31	-0.67	-0.26	38.02	33.33	24.50	-0.28	-0.32	-0.33	circle	97
98	Poing	35.94	33.51	20.79	-0.35	-0.15	-0.49	37.50	33.51	23.21	-0.33	-0.31	-0.41	Poing	98
99	Phyre2	35.94	33.51	20.79	-0.35	-0.15	-0.49	37.50	33.51	23.21	-0.33	-0.31	-0.41	Phyre2	99
100	Phragment	35.94	33.51	20.79	-0.35	-0.15	-0.49	37.50	33.51	23.21	-0.33	-0.31	-0.41	Phragment	100
101	rehtnap	35.94	32.99	25.29	-0.35	-0.19	-0.15	38.02	33.16	25.29	-0.28	-0.34	-0.28	rehtnap	101
102	mGenTHREADER	35.94	32.81	23.55	-0.35	-0.21	-0.28	35.94	32.81	23.55	-0.46	-0.37	-0.39	mGenTHREADER	102
103	keasar	35.94	32.81	22.06	-0.35	-0.21	-0.39	36.98	33.51	24.85	-0.37	-0.31	-0.31	keasar	103
104	SAM−T02−server	35.94	32.81	23.55	-0.35	-0.21	-0.28	36.98	34.03	23.55	-0.37	-0.27	-0.39	SAM−T02−server	104
105	Jiang_Zhu	35.94	32.81	22.60	-0.35	-0.21	-0.35	35.94	32.81	22.60	-0.46	-0.37	-0.45	Jiang_Zhu	105
106	3D−JIGSAW_AEP	35.94	31.94	21.79	-0.35	-0.28	-0.41	36.46	31.94	21.80	-0.41	-0.44	-0.51	3D−JIGSAW_AEP	106
107	SMEG−CCP	35.94	31.77	20.49	-0.35	-0.30	-0.51	35.94	31.77	20.49	-0.46	-0.45	-0.59	SMEG−CCP	107
108	SAM−T06−server	35.94	31.77	21.82	-0.35	-0.30	-0.41	36.98	32.81	23.55	-0.37	-0.37	-0.39	SAM−T06−server	108
109	3D−JIGSAW_V3	35.94	31.25	21.33	-0.35	-0.35	-0.45	36.46	31.25	21.49	-0.41	-0.49	-0.53	3D−JIGSAW_V3	109
110	PS2−server	35.94	30.90	23.91	-0.35	-0.38	-0.26	38.02	34.38	23.91	-0.28	-0.24	-0.37	PS2−server	110
111	COMA−M	35.94	30.90	23.86	-0.35	-0.38	-0.26	35.94	33.33	23.96	-0.46	-0.32	-0.37	COMA−M	111
112	mumssp	35.94	30.90	22.76	-0.35	-0.38	-0.34	35.94	30.90	22.76	-0.46	-0.52	-0.44	mumssp	112
113	PS2−manual	35.94	30.90	23.91	-0.35	-0.38	-0.26	38.02	34.38	23.91	-0.28	-0.24	-0.37	PS2−manual	113
114	COMA	35.94	30.56	24.04	-0.35	-0.41	-0.25	80.21	78.12	76.33	3.18	3.26	3.07	COMA	114
115	nFOLD3	35.94	30.21	21.18	-0.35	-0.44	-0.46	36.98	34.03	22.91	-0.37	-0.27	-0.43	nFOLD3	115
116	YASARA	35.94	30.21	21.70	-0.35	-0.44	-0.42	36.98	31.94	23.33	-0.37	-0.44	-0.41	YASARA	116
117	JIVE08	35.42	33.85	19.07	-0.40	-0.12	-0.62	36.46	33.85	21.44	-0.41	-0.28	-0.53	JIVE08	117
118	PRI−Yang−KiharA	35.42	32.81	22.96	-0.40	-0.21	-0.33	35.42	32.81	22.96	-0.50	-0.37	-0.43	PRI−Yang−KiharA	118
119	TWPPLAB	35.42	32.81	21.84	-0.40	-0.21	-0.41	35.42	32.81	21.84	-0.50	-0.37	-0.50	TWPPLAB	119
120	Ozkan−Shell	35.42	31.25	20.97	-0.40	-0.35	-0.48	36.46	33.33	20.97	-0.41	-0.32	-0.56	Ozkan−Shell	120
121	FLOUDAS	35.42	30.90	25.73	-0.40	-0.38	-0.12	35.42	32.64	27.72	-0.50	-0.38	-0.12	FLOUDAS	121
122	Pushchino	35.42	30.38	21.29	-0.40	-0.42	-0.45	35.42	30.38	21.29	-0.50	-0.56	-0.54	Pushchino	122
123	A−TASSER	34.90	32.47	18.80	-0.45	-0.24	-0.64	35.94	35.07	22.96	-0.46	-0.19	-0.43	A−TASSER	123
124	Jones−UCL	34.90	31.42	22.22	-0.45	-0.33	-0.38	36.98	31.60	22.46	-0.37	-0.46	-0.46	Jones−UCL	124
125	DistillSN	34.90	30.04	22.93	-0.45	-0.45	-0.33	42.71	34.38	26.29	0.10	-0.24	-0.21	DistillSN	125
126	RPFM	32.81	25.52	23.91	-0.64	-0.85	-0.26	57.81	40.10	52.08	1.34	0.22	1.48	RPFM	126
127	Pcons_local	30.73	23.79	13.42	-0.84	-1.00	-1.04	30.73	23.79	15.89	-0.88	-1.09	-0.89	Pcons_local	127
128	BHAGEERATH				0.22	0.01	1.11				0.05	-0.16	0.82	BHAGEERATH	128
129	CBSU				0.22	0.01	1.11				0.05	-0.16	0.82	CBSU	129
130	FEIG_REFINE				0.22	0.01	1.11				0.05	-0.16	0.82	FEIG_REFINE	130
131	HCA				0.22	0.01	1.11				0.05	-0.16	0.82	HCA	131
132	Handl−Lovell				0.22	0.01	1.11				0.05	-0.16	0.82	Handl−Lovell	132
133	KudlatyPredHuman				0.22	0.01	1.11				0.05	-0.16	0.82	KudlatyPredHuman	133
134	LEE−SERVER				0.22	0.01	1.11				0.05	-0.16	0.82	LEE−SERVER	134
135	Linnolt−UH−CMB				0.22	0.01	1.11				0.05	-0.16	0.82	Linnolt−UH−CMB	135
136	Nano_team				0.22	0.01	1.11				0.05	-0.16	0.82	Nano_team	136
137	NirBenTal				0.22	0.01	1.11				0.05	-0.16	0.82	NirBenTal	137
138	PHAISTOS				0.22	0.01	1.11				0.05	-0.16	0.82	PHAISTOS	138
139	POISE				0.22	0.01	1.11				0.05	-0.16	0.82	POISE	139
140	PZ−UAM				0.22	0.01	1.11				0.05	-0.16	0.82	PZ−UAM	140
141	ProtAnG				0.22	0.01	1.11				0.05	-0.16	0.82	ProtAnG	141
142	ProteinShop				0.22	0.01	1.11				0.05	-0.16	0.82	ProteinShop	142
143	SAINT1				0.22	0.01	1.11				0.05	-0.16	0.82	SAINT1	143
144	SHORTLE				0.22	0.01	1.11				0.05	-0.16	0.82	SHORTLE	144
145	Sasaki−Cetin−Sasai				0.22	0.01	1.11				0.05	-0.16	0.82	Sasaki−Cetin−Sasai	145
146	Scheraga				0.22	0.01	1.11				0.05	-0.16	0.82	Scheraga	146
147	ShakAbInitio				0.22	0.01	1.11				0.05	-0.16	0.82	ShakAbInitio	147
148	TsaiLab				0.22	0.01	1.11				0.05	-0.16	0.82	TsaiLab	148
149	UCDavisGenome				0.22	0.01	1.11				0.05	-0.16	0.82	UCDavisGenome	149
150	Wolynes				0.22	0.01	1.11				0.05	-0.16	0.82	Wolynes	150
151	YASARARefine				0.22	0.01	1.11				0.05	-0.16	0.82	YASARARefine	151
152	Zhou−SPARKS				0.22	0.01	1.11				0.05	-0.16	0.82	Zhou−SPARKS	152
153	dill_ucsf				0.22	0.01	1.11				0.05	-0.16	0.82	dill_ucsf	153
154	dill_ucsf_extended				0.22	0.01	1.11				0.05	-0.16	0.82	dill_ucsf_extended	154
155	fais−server				0.22	0.01	1.11				0.05	-0.16	0.82	fais−server	155
156	fais@hgc				0.22	0.01	1.11				0.05	-0.16	0.82	fais@hgc	156
157	igor				0.22	0.01	1.11				0.05	-0.16	0.82	igor	157
158	jacobson				0.22	0.01	1.11				0.05	-0.16	0.82	jacobson	158
159	mti				0.22	0.01	1.11				0.05	-0.16	0.82	mti	159
160	panther_server				0.22	0.01	1.11				-0.37	-0.16	0.82	panther_server	160
161	psiphifoldings				0.22	0.01	1.11				0.05	-0.16	0.82	psiphifoldings	161
162	ricardo				0.22	0.01	1.11				0.05	-0.16	0.82	ricardo	162
163	rivilo				0.22	0.01	1.11				0.05	-0.16	0.82	rivilo	163
164	sessions				0.22	0.01	1.11				0.05	-0.16	0.82	sessions	164
165	taylor				0.22	0.01	1.11				0.05	-0.16	0.82	taylor	165
166	test_http_server_01				0.22	0.01	1.11				0.05	-0.16	0.82	test_http_server_01	166

¹⁾ He Y, Chen Y, Alexander P, Bryan PN, Orban J. (2008) "NMR structures of two designed proteins with high sequence identity but different fold and function." Proc Natl Acad Sci U S A. Sep 16. [Epub ahead of print], PMID: 18796611

Targets
387	388	389	390
391	392	393	394
395	396	397	398
399	400	401	402
403	404	405	406
407	408	409	410
411	412	413	414
415	416	417	418
419	420	421	422
423	424	425	426
427	428	429	430
431	432	433	434
435	436	437	438
439	440	441	442
443	444	445	446
447	448	449	450
451	452	453	454
455	456	457	458
459	460	461	462
463	464	465	466
467	468	469	470
471	472	473	474
475	476	477	478
479	480	481	482
483	484	485	486
487	488	489	490
491	492	493	494
495	496	497	498
499	500	501	502
503	504	505	506
507	508	509	510
511	512	513	514