T0507

Targets
387 388 389 390
391 392 393 394
395 396 397 398
399 400 401 402
403 404 405 406
407 408 409 410
411 412 413 414
415 416 417 418
419 420 421 422
423 424 425 426
427 428 429 430
431 432 433 434
435 436 437 438
439 440 441 442
443 444 445 446
447 448 449 450
451 452 453 454
455 456 457 458
459 460 461 462
463 464 465 466
467 468 469 470
471 472 473 474
475 476 477 478
479 480 481 482
483 484 485 486
487 488 489 490
491 492 493 494
495 496 497 498
499 500 501 502
503 504 505 506
507 508 509 510
511 512 513 514

T0507

protein APC60073 from Archaeoglobus fulgidus

Target type: Server only

Target sequence:

>T0507 APC60073, Archaeoglobus fulgidus, 148 residues
MKVALGGTFEPLHEGHKKLIDVAIKLGGRDITIGVTSDRMARARIRSVLPFAIRAENVKRYVMRKYGFEPEIVKITNPYGKTLDVDFEYLVVSPETYEMALKINQKREELGKRKITIVKVDWMMAEDGKPISSTRIKRGEIDRYGGII

Structure:
Method: X-ray, res=1.6Å, R/Rfree=0.17/0.21
Determined by: MCSG
PDB ID: 3do8

3do8_A cartoon
Cartoon diagram of 507: 3do8 chain A

PyMOL of 3do8

Domains:  PyMOL of domains

Single domain protein.

Structure classification:

Nucleotidylyl transferase from the Adenine nucleotide alpha hydrolase-like fold.

CASP category:

Comparative modeling:hard.

Closest templates:

1f9a, 1yum, 1o6b, 1qjc, 1od6.

Target sequence - PDB file inconsistencies:

T0507    3do8.pdb    T0507.pdb    PyMOL    PyMOL of domains    

T0507    1 MKVALGGTFEPLHEGHKKLIDVAIKLGGRDITIGVTSDRMARARIRSVLPFAIRAENVKRYVMRKYGFEPEIVKITNPYGKTLDVDFEYLVVSPETYEMALKINQKREELGKRKITIVKVDWMMAEDGKPISSTRIKRGEIDRYGGII 148
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~|||||||||||~~~~~~
3do8A    1 MKVALGGTFEPLHEGHKKLIDVAIKLGGRDITIGVTSDRMARARIRSVLPFAIRAENVKRYVMRKYGFEPEIVKITNPYGKTLDVDFEYLVVSPETYEMALKINQKREELGKRKITIVKVDWMM-------SSTRIKRGEID------ 142

Single domain protein: target 1-124, 132-142 ; pdb 1-124, 132-142

Sequence classification:

Cytidylyltransferase family CTP_transf_2 in Pfam.

Server predictions:

T0507:pdb 1-142:seq 1-142:CM_hard;   alignment

distribution of first scores
First models for T0507: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

# GROUP ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ ↓ GROUP #
T0507 T0507 T0507 T0507
First score First Z-score Best score Best Z-score
1 FEIG 62.78 52.90 62.46 2.69 1.76 2.07 62.78 54.51 65.16 2.45 1.63 2.40 FEIG 1
2 LEE−SERVER 62.22 54.07 64.20 2.56 2.00 2.36 64.44 55.31 65.68 2.86 1.80 2.49 LEE−SERVER 2
3 pro−sp3−TASSER 61.48 51.98 63.56 2.40 1.58 2.25 61.48 53.52 63.56 2.12 1.41 2.10 pro−sp3−TASSER 3
4 METATASSER 58.33 52.28 62.77 1.70 1.64 2.12 61.67 58.09 65.38 2.17 2.42 2.44 METATASSER 4
5 MUSTER 57.59 53.77 58.63 1.53 1.94 1.41 59.44 55.74 58.84 1.62 1.90 1.22 MUSTER 5
6 RAPTOR 57.59 50.12 56.57 1.53 1.20 1.06 57.59 51.42 56.57 1.16 0.94 0.80 RAPTOR 6
7 MULTICOM−CMFR 57.04 49.69 60.12 1.41 1.11 1.67 57.04 49.69 60.12 1.03 0.56 1.46 MULTICOM−CMFR 7
8 Zhang−Server 56.85 50.93 55.89 1.37 1.36 0.95 63.15 56.11 64.52 2.54 1.98 2.28 Zhang−Server 8
9 FFASsuboptimal 56.11 50.93 55.57 1.20 1.36 0.89 56.48 52.28 56.04 0.89 1.13 0.70 FFASsuboptimal 9
10 mariner1 55.93 47.53 50.97 1.16 0.67 0.11 60.00 53.70 61.56 1.76 1.45 1.73 mariner1 10
11 PS2−server 55.00 51.17 58.21 0.96 1.41 1.34 56.11 51.17 58.21 0.80 0.88 1.10 PS2−server 11
12 Poing 54.63 49.32 54.45 0.87 1.03 0.70 54.63 49.32 54.45 0.43 0.47 0.40 Poing 12
13 Phyre2 54.63 49.32 54.54 0.87 1.03 0.72 54.63 49.32 54.54 0.43 0.47 0.42 Phyre2 13
14 Phragment 54.63 49.32 54.29 0.87 1.03 0.68 54.63 49.32 54.29 0.43 0.47 0.37 Phragment 14
15 SAM−T08−server 54.26 49.07 56.15 0.79 0.98 0.99 54.26 49.07 56.15 0.34 0.42 0.72 SAM−T08−server 15
16 CpHModels 53.70 47.41 47.47 0.67 0.64 -0.49 53.70 47.41 47.47 0.20 0.05 -0.90 CpHModels 16
17 GS−MetaServer2 52.59 42.72 50.30 0.42 -0.31 -0.00 53.89 48.21 50.97 0.25 0.23 -0.25 GS−MetaServer2 17
18 HHpred5 52.22 48.40 50.59 0.34 0.85 0.05 52.22 48.40 50.59 -0.16 0.27 -0.32 HHpred5 18
19 GeneSilicoMetaServer 51.85 44.94 53.63 0.26 0.14 0.56 54.26 47.22 55.17 0.34 0.01 0.54 GeneSilicoMetaServer 19
20 FALCON_CONSENSUS 51.67 48.09 53.14 0.22 0.78 0.48 51.67 48.09 53.14 -0.30 0.20 0.16 FALCON_CONSENSUS 20
21 pipe_int 51.67 47.72 53.67 0.22 0.71 0.57 51.67 48.21 53.67 -0.30 0.23 0.26 pipe_int 21
22 GS−KudlatyPred 51.48 46.42 51.79 0.17 0.44 0.25 51.48 46.42 53.07 -0.35 -0.17 0.15 GS−KudlatyPred 22
23 FFASstandard 51.30 46.98 45.82 0.13 0.56 -0.77 51.85 47.53 47.49 -0.25 0.08 -0.89 FFASstandard 23
24 FFASflextemplate 51.30 46.98 45.82 0.13 0.56 -0.77 51.85 47.53 46.24 -0.25 0.08 -1.13 FFASflextemplate 24
25 Phyre_de_novo 51.30 46.11 51.09 0.13 0.38 0.13 51.30 46.11 51.09 -0.39 -0.24 -0.22 Phyre_de_novo 25
26 MULTICOM−REFINE 51.30 44.88 52.15 0.13 0.13 0.31 51.30 44.88 52.48 -0.39 -0.51 0.04 MULTICOM−REFINE 26
27 ACOMPMOD 51.11 44.81 50.90 0.09 0.11 0.10 53.70 47.90 51.45 0.20 0.16 -0.16 ACOMPMOD 27
28 COMA−M 50.93 42.53 54.25 0.05 -0.35 0.67 51.11 44.44 54.25 -0.44 -0.61 0.37 COMA−M 28
29 MUProt 50.74 38.15 52.04 0.01 -1.24 0.29 51.11 47.53 53.14 -0.44 0.08 0.16 MUProt 29
30 HHpred4 50.56 40.31 43.40 -0.03 -0.80 -1.18 50.56 40.31 43.40 -0.57 -1.53 -1.65 HHpred4 30
31 fais−server 50.37 41.85 44.98 -0.07 -0.49 -0.91 54.26 51.17 52.41 0.34 0.88 0.02 fais−server 31
32 Pcons_multi 50.37 41.73 54.31 -0.07 -0.51 0.68 52.59 48.52 54.72 -0.07 0.30 0.45 Pcons_multi 32
33 forecast 50.19 42.90 52.89 -0.11 -0.27 0.44 50.19 44.07 53.07 -0.66 -0.69 0.15 forecast 33
34 3DShot2 50.19 41.30 49.89 -0.11 -0.60 -0.07 50.19 41.30 49.89 -0.66 -1.31 -0.45 3DShot2 34
35 Pushchino 50.00 41.48 46.82 -0.16 -0.56 -0.60 50.00 41.48 46.82 -0.71 -1.27 -1.02 Pushchino 35
36 3Dpro 49.63 41.60 50.94 -0.24 -0.54 0.11 49.81 45.06 51.83 -0.76 -0.47 -0.09 3Dpro 36
37 HHpred2 49.44 40.06 46.34 -0.28 -0.85 -0.68 49.44 40.06 46.34 -0.85 -1.58 -1.11 HHpred2 37
38 nFOLD3 49.07 45.86 39.39 -0.36 0.33 -1.86 50.19 47.72 45.81 -0.66 0.12 -1.21 nFOLD3 38
39 FALCON 49.07 45.62 50.90 -0.36 0.28 0.10 51.67 48.09 53.14 -0.30 0.20 0.16 FALCON 39
40 BioSerf 49.07 45.12 50.03 -0.36 0.18 -0.05 49.07 45.12 50.03 -0.94 -0.46 -0.42 BioSerf 40
41 SAM−T06−server 49.07 42.41 51.76 -0.36 -0.37 0.25 50.56 46.85 51.76 -0.57 -0.08 -0.10 SAM−T06−server 41
42 circle 49.07 41.42 50.44 -0.36 -0.58 0.02 50.19 48.21 51.46 -0.66 0.23 -0.15 circle 42
43 COMA 48.89 44.57 48.74 -0.40 0.07 -0.27 51.11 44.57 54.25 -0.44 -0.58 0.37 COMA 43
44 FOLDpro 48.52 45.06 51.83 -0.48 0.17 0.26 50.37 45.06 51.83 -0.62 -0.47 -0.09 FOLDpro 44
45 BAKER−ROBETTA 48.52 41.36 50.95 -0.48 -0.59 0.11 50.93 46.36 52.67 -0.48 -0.18 0.07 BAKER−ROBETTA 45
46 panther_server 48.33 43.40 40.31 -0.53 -0.17 -1.70 52.22 43.40 45.06 -0.16 -0.84 -1.35 panther_server 46
47 PSI 48.33 42.53 43.11 -0.53 -0.35 -1.23 54.26 48.58 49.98 0.34 0.31 -0.43 PSI 47
48 mGenTHREADER 48.15 44.57 45.67 -0.57 0.07 -0.79 48.15 44.57 45.67 -1.17 -0.58 -1.23 mGenTHREADER 48
49 MULTICOM−CLUSTER 48.15 41.60 50.00 -0.57 -0.54 -0.05 56.85 50.06 58.54 0.98 0.64 1.16 MULTICOM−CLUSTER 49
50 Frankenstein 47.96 39.94 49.83 -0.61 -0.88 -0.08 52.78 49.44 49.83 -0.02 0.50 -0.46 Frankenstein 50
51 Pcons_dot_net 47.59 42.90 52.22 -0.69 -0.27 0.32 52.22 48.40 52.22 -0.16 0.27 -0.01 Pcons_dot_net 51
52 FAMSD 47.22 42.90 50.14 -0.77 -0.27 -0.03 55.00 46.23 50.64 0.52 -0.21 -0.31 FAMSD 52
53 FUGUE_KM 47.04 38.77 37.72 -0.81 -1.12 -2.14 50.56 47.47 46.26 -0.57 0.06 -1.12 FUGUE_KM 53
54 MULTICOM−RANK 46.11 39.57 49.76 -1.02 -0.95 -0.10 47.22 42.04 49.76 -1.40 -1.14 -0.47 MULTICOM−RANK 54
55 3D−JIGSAW_AEP 45.93 38.15 41.18 -1.06 -1.24 -1.56 47.96 38.15 42.83 -1.22 -2.01 -1.76 3D−JIGSAW_AEP 55
56 3D−JIGSAW_V3 45.56 36.42 44.30 -1.14 -1.60 -1.02 47.22 37.59 44.92 -1.40 -2.13 -1.37 3D−JIGSAW_V3 56
57 rehtnap 45.37 40.37 33.43 -1.19 -0.79 -2.88 45.37 40.37 33.43 -1.86 -1.51 -3.51 rehtnap 57
58 Pcons_local 44.07 37.78 47.87 -1.47 -1.32 -0.42 51.48 47.04 50.96 -0.35 -0.03 -0.25 Pcons_local 58
59 SAM−T02−server 41.48 34.44 33.21 -2.05 -2.00 -2.91 41.48 35.12 35.10 -2.82 -2.68 -3.20 SAM−T02−server 59
60 OLGAFS 40.93 32.04 37.36 -2.17 -2.49 -2.21 40.93 32.04 37.36 -2.95 -3.36 -2.78 OLGAFS 60
61 MUFOLD−Server 38.15 32.04 38.91 -2.79 -2.49 -1.94 48.89 42.10 45.35 -0.99 -1.13 -1.29 MUFOLD−Server 61
62 Fiser−M4T 35.37 32.41 14.76 -3.41 -2.41 -6.05 35.37 32.41 14.76 -4.33 -3.28 -6.99 Fiser−M4T 62
63 MUFOLD−MD 34.63 26.73 42.60 -3.57 -3.57 -1.31 34.63 26.73 42.60 -4.51 -4.54 -1.80 MUFOLD−MD 63
64 huber−torda−server 32.41 24.51 27.62 -4.07 -4.02 -3.86 45.37 34.38 38.42 -1.86 -2.84 -2.58 huber−torda−server 64
65 RBO−Proteus 26.85 20.86 47.62 -5.31 -4.77 -0.46 26.85 21.98 47.62 -6.43 -5.60 -0.87 RBO−Proteus 65
66 Distill 26.48 19.20 37.49 -5.39 -5.10 -2.18 27.59 22.04 40.96 -6.25 -5.59 -2.11 Distill 66
67 LOOPP_Server 19.07 15.00 21.40 -7.04 -5.96 -4.92 61.11 56.42 55.96 2.03 2.05 0.68 LOOPP_Server 67
68 RANDOM 16.87 13.62 16.87 -7.53 -6.24 -5.69 16.87 13.62 16.87 -8.89 -7.46 -6.60 RANDOM 68
69 schenk−torda−server 14.26 13.39 17.77 -8.11 -6.29 -5.54 17.04 14.20 21.67 -8.85 -7.33 -5.70 schenk−torda−server 69
70 BHAGEERATH                   -7.53 -6.24 -5.69                   -8.89 -7.46 -6.60 BHAGEERATH 70
71 YASARA                   -7.53 -6.24 -5.69                   -8.89 -7.46 -6.60 YASARA 71
72 keasar−server                   -7.53 -6.24 -5.69                   -8.89 -7.46 -6.60 keasar−server 72
73 mahmood−torda−server                   -7.53 -6.24 -5.69                   -8.89 -7.46 -6.60 mahmood−torda−server 73
74 test_http_server_01                   -7.53 -6.24 -5.69                   -8.89 -7.46 -6.60 test_http_server_01 74