T0439

Targets
387 388 389 390
391 392 393 394
395 396 397 398
399 400 401 402
403 404 405 406
407 408 409 410
411 412 413 414
415 416 417 418
419 420 421 422
423 424 425 426
427 428 429 430
431 432 433 434
435 436 437 438
439 440 441 442
443 444 445 446
447 448 449 450
451 452 453 454
455 456 457 458
459 460 461 462
463 464 465 466
467 468 469 470
471 472 473 474
475 476 477 478
479 480 481 482
483 484 485 486
487 488 489 490
491 492 493 494
495 496 497 498
499 500 501 502
503 504 505 506
507 508 509 510
511 512 513 514

T0439

TrpR binding protein WrbA Agrobacterium tumefaciens str. C58

Target type: Server only

Target sequence:

>T0439 TrpR binding protein WrbA, Agrobacterium tumefaciens str. C58, 223 residues
MIIEFLKKLLAGTPETVPAKETKRMTKVLVLYYSSYGHIETMAYAVAEGVESTGAEAVVKRVPELVPEEVAKSSHFKMDQPAPVATVDELAEYDAIIVGAGTRFGTVASQMRNFWDQTGGLWFSGKLVGKVGSAFTSSATQHGGQESTILGFIPTFLHHGMAVVGLPYAFQGQMGVDEIKGGSPYGASTITDGDGSRQPSAIELDAARYQGAHVAKLAAKLSA

Structure:
No structure will be available any time soon.
Could be determined by: MCSG

Domains:

Single domain protein.

Structure classification:

Flavodoxin fold.

CASP category:

Unknown.

Closest templates:

5nul.

Target sequence - PDB file inconsistencies:

N/A - no structure

Sequence classification:

Flavodoxin (Flavodoxin_1) family in Pfam.

Server predictions:

Will be added here at some point.