T0399

Targets
387 388 389 390
391 392 393 394
395 396 397 398
399 400 401 402
403 404 405 406
407 408 409 410
411 412 413 414
415 416 417 418
419 420 421 422
423 424 425 426
427 428 429 430
431 432 433 434
435 436 437 438
439 440 441 442
443 444 445 446
447 448 449 450
451 452 453 454
455 456 457 458
459 460 461 462
463 464 465 466
467 468 469 470
471 472 473 474
475 476 477 478
479 480 481 482
483 484 485 486
487 488 489 490
491 492 493 494
495 496 497 498
499 500 501 502
503 504 505 506
507 508 509 510
511 512 513 514

T0399

putative beta-lactamase inhibitor protein from Streptococcus mutans

Target type: Human/Server

Target sequence:

>T0399 Putative beta-lactamase inhibitor protein, Streptococcus mutans, 206 residues
MSMKKTKNWLLVFLTVTFCFLMLGCQSKEDKKGGTKPSNEAALTKTENLDFRLSFNKIKVTTDQNHFSGGTSIEQLKQWFGDPNKSEQRNAGNITLDSYTWVKDGAVINAQLYKNSTVARSISNFSFSREAKIGKEDYDELKIGESYKKVVEKLGEPDVLSQSMSSDKEEMQTVWSSGIKTKSSSATIELYFENGLLKNKTQKDLE

Structure:
Method: X-ray, res=1.4Å, R/Rfree=0.18/0.20
Determined by: JCSG
PDB ID: 3d4e

3d4e cartoon
Cartoon diagram of 399: 3d4e

PyMOL of 3d4e

Domains:  PyMOL of domains

Single domain protein, but a duplication of an ancestral unit.

399 domain evaluation plot
Correlation between weighted by the number of residues sum of GDT-TS scores for domain-based evlatuation (y, vertical axis) and whole chain GDT-TS (x, horizontal axis).

To compute the weighted sum, GDT-TS for each domain was multiplied by the domain length, and this sum was divided by the sum of domain lengths. Each point represents first server model. Green, gray and black points are top 10, bottom 25% and the rest of prediction models. Blue line is the best-fit slope line (intersection 0) to the top 10 server models. Red line is the diagonal. Slope and root mean square y-x distance for the top 10 models (average difference between the weighted sum of domain GDT-TS scores and the whole chain GDT-TS score) are shown above the plot.

Structure classification:

BLIP: beta-lactamase-inhibitor protein fold.

CASP category:

Whole chain: Fold recognition.

1st domain: Fold recognition. 2nd domain: Comparative modeling:medium.

Closest templates:

2g2u.

Target sequence - PDB file inconsistencies:

T0399    3d4e.pdb    T0399.pdb    PyMOL    PyMOL of domains    

T0399    1 MSMKKTKNWLLVFLTVTFCFLMLGCQSKEDKKGGTKPSNEAALTKTENLDFRLSFNKIKVTTDQNHFSGGTSIEQLKQWFGDPNKSEQRNAGNITLDSYTWVKDGAVINAQLYKNSTVARSISNFSFSREAKIGKEDYDELKIGESYKKVVEKLGEPDVLSQSMSSDKEEMQTVWSSGIKTKSSSATIELYFENGLLKNKTQKDLE 206
           ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||:||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3d4eA   45 --------------------------------------------KTENLDFRLSFNKIKVTTDQNHFSGGTSIEQLKQWFGDPNKSEQRNAGNITLDSYTWVKDGAVINAQLYKNSTVARSISNFSFSREAKIGKEDYDELKIGESYKKIVEKLGEPDVLSQSMSSDKEEMQTVWSSGIKTKSSSATIELYFENGLLKNKTQKDLE 206

Residue change log: change 150 I to V; change 164, 171, MSE to MET;

We suggest to evaluate this target as a single domain spanning whole chain. However, evolutionarily this is a 2-domain protein (a duplication of an ancestral unit):

1st domain: target 45-128 ; pdb 45-128

2nd domain: target 129-206 ; pdb 129-206

Sequence classification:

Not similar to Pfam and CDD families. Apparently a BLIP.

Server predictions:

T0399:pdb 45-206:seq 45-206:FR;   alignment

distribution of first scores
First models for T0399: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

399_1:pdb 45-128:seq 45-128:FR;   alignment

distribution of first scores
First models for T0399_1: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

399_2:pdb 129-206:seq 129-206:CM_medium;   alignment

distribution of first scores
First models for T0399_2: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

# GROUP ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ ↓ GROUP #
T0399 399_1 399_2 T0399 399_1 399_2 T0399 399_1 399_2 T0399 399_1 399_2
First score First Z-score Best score Best Z-score
1 SHORTLE 51.85 43.83 45.83 44.94 40.58 41.51 66.67 55.77 66.30 1.24 1.38 0.46 0.67 0.96 0.32 0.49 0.28 0.54 51.85 43.83 45.83 44.94 40.58 41.51 66.67 55.77 66.30 1.15 1.25 0.24 0.33 0.54 -0.04 0.36 0.02 0.39 SHORTLE 1
2 HHpred2 50.93 42.80 54.27 52.98 48.02 50.32 71.80 65.39 72.16 1.16 1.27 1.33 1.56 1.89 1.38 0.84 0.98 1.00 50.93 42.80 54.27 52.98 48.02 50.32 71.80 65.39 72.16 1.05 1.13 1.23 1.24 1.46 1.09 0.78 0.87 0.92 HHpred2 2
3 fais−server 49.85 41.20 54.39 49.41 39.88 51.02 71.47 65.70 72.59 1.06 1.09 1.34 1.16 0.87 1.46 0.82 1.01 1.04 49.85 41.20 54.39 49.41 39.88 51.02 71.47 65.70 72.59 0.94 0.92 1.25 0.84 0.46 1.18 0.75 0.89 0.96 fais−server 3
4 fais@hgc 49.85 41.20 54.39 49.41 39.88 52.49 71.47 65.70 72.59 1.06 1.09 1.34 1.16 0.87 1.64 0.82 1.01 1.04 49.85 43.00 54.39 49.41 41.07 52.49 71.47 65.70 72.59 0.94 1.15 1.25 0.84 0.60 1.37 0.75 0.89 0.96 fais@hgc 4
5 IBT_LT 49.69 39.40 54.53 54.76 40.87 52.30 70.51 59.62 72.74 1.05 0.88 1.36 1.75 0.99 1.61 0.75 0.56 1.05 49.69 39.40 54.53 54.76 40.87 52.30 70.51 59.62 72.74 0.93 0.70 1.26 1.44 0.58 1.35 0.67 0.36 0.97 IBT_LT 5
6 mGenTHREADER 49.54 41.31 50.77 55.66 48.21 48.07 68.91 55.45 67.01 1.03 1.10 0.97 1.85 1.91 1.11 0.64 0.26 0.60 49.54 41.31 50.77 55.66 48.21 48.07 68.91 55.45 67.01 0.91 0.94 0.82 1.54 1.48 0.80 0.54 -0.01 0.46 mGenTHREADER 6
7 fams−ace2 49.54 40.48 53.78 47.92 43.35 51.84 71.80 63.89 72.01 1.03 1.00 1.28 1.00 1.30 1.56 0.84 0.87 0.99 49.54 40.48 53.78 49.11 46.73 51.84 71.80 63.89 72.01 0.91 0.83 1.17 0.80 1.30 1.29 0.78 0.73 0.90 fams−ace2 7
8 DBAKER 49.54 40.17 48.03 54.17 49.80 50.41 64.42 58.87 61.73 1.03 0.97 0.69 1.69 2.11 1.39 0.34 0.51 0.19 49.54 40.17 48.13 54.76 50.40 51.57 64.42 60.04 61.73 0.91 0.80 0.51 1.44 1.75 1.25 0.18 0.40 -0.02 DBAKER 8
9 HHpred4 49.38 38.48 54.68 56.25 49.31 53.68 66.99 57.16 69.15 1.02 0.78 1.37 1.92 2.05 1.78 0.51 0.38 0.77 49.38 38.48 54.68 56.25 49.31 53.68 66.99 57.16 69.15 0.89 0.58 1.28 1.61 1.62 1.52 0.39 0.14 0.65 HHpred4 9
10 HHpred5 49.38 38.48 54.68 56.25 49.31 53.68 66.99 57.16 69.15 1.02 0.78 1.37 1.92 2.05 1.78 0.51 0.38 0.77 49.38 38.48 54.68 56.25 49.31 53.68 66.99 57.16 69.15 0.89 0.58 1.28 1.61 1.62 1.52 0.39 0.14 0.65 HHpred5 10
11 Phragment 49.07 43.00 52.07 45.24 41.07 49.67 67.95 58.97 69.09 0.99 1.29 1.10 0.70 1.02 1.30 0.58 0.51 0.76 49.54 43.00 53.74 47.92 42.96 53.06 67.95 58.97 69.09 0.91 1.15 1.17 0.67 0.83 1.44 0.47 0.30 0.64 Phragment 11
12 Poing 48.77 42.39 50.47 45.83 40.48 46.43 67.95 58.97 69.09 0.96 1.22 0.94 0.77 0.95 0.91 0.58 0.51 0.76 48.92 42.75 51.69 47.32 42.16 48.89 67.95 58.97 69.09 0.85 1.12 0.93 0.60 0.74 0.91 0.47 0.30 0.64 Poing 12
13 Phyre2 48.77 40.74 52.62 50.89 39.98 51.81 67.31 58.76 68.05 0.96 1.03 1.16 1.33 0.88 1.56 0.54 0.50 0.68 48.77 40.74 52.62 50.89 39.98 51.81 67.31 58.76 68.05 0.83 0.87 1.04 1.00 0.47 1.28 0.41 0.28 0.55 Phyre2 13
14 Sternberg 48.61 40.59 54.75 50.89 39.98 57.45 67.31 58.76 68.05 0.95 1.02 1.38 1.33 0.88 2.23 0.54 0.50 0.68 48.77 40.74 54.94 50.89 39.98 57.83 67.31 58.76 68.05 0.83 0.87 1.31 1.00 0.47 2.06 0.41 0.28 0.55 Sternberg 14
15 Phyre_de_novo 48.46 40.12 51.83 47.02 39.09 49.17 67.95 58.97 69.09 0.94 0.96 1.08 0.90 0.77 1.24 0.58 0.51 0.76 48.46 42.18 51.83 47.02 42.16 49.17 67.95 58.97 69.09 0.80 1.05 0.94 0.57 0.74 0.94 0.47 0.30 0.64 Phyre_de_novo 15
16 GeneSilico 47.99 40.69 51.50 49.11 38.99 48.59 68.91 62.93 68.23 0.89 1.03 1.04 1.13 0.76 1.17 0.64 0.80 0.70 48.61 40.69 51.50 49.11 38.99 48.59 73.40 68.91 68.23 0.82 0.86 0.91 0.80 0.35 0.87 0.91 1.18 0.57 GeneSilico 16
17 3DShot1 47.99 39.35 46.64 46.43 37.50 39.35 70.51 56.41 70.37 0.89 0.88 0.54 0.84 0.57 0.06 0.75 0.33 0.86 47.99 39.35 46.64 46.43 37.50 39.35 70.51 56.41 70.37 0.75 0.69 0.33 0.50 0.16 -0.32 0.67 0.08 0.76 3DShot1 17
18 circle 47.22 39.20 44.54 44.05 40.48 34.48 71.80 60.04 68.87 0.82 0.86 0.32 0.57 0.95 -0.52 0.84 0.59 0.75 48.46 39.20 51.52 53.27 44.44 50.75 71.80 62.71 68.87 0.80 0.67 0.91 1.27 1.02 1.15 0.78 0.63 0.62 circle 18
19 Elofsson 47.22 38.17 51.11 47.02 38.99 46.81 70.19 58.87 71.66 0.82 0.75 1.00 0.90 0.76 0.96 0.73 0.51 0.96 47.84 38.17 52.20 50.89 40.77 48.45 70.51 65.28 71.82 0.74 0.54 0.99 1.00 0.56 0.85 0.67 0.86 0.89 Elofsson 19
20 FAMS−multi 46.76 39.35 52.22 45.83 39.29 48.67 71.15 67.31 72.05 0.78 0.88 1.12 0.77 0.80 1.18 0.80 1.13 0.99 47.69 39.87 52.22 45.83 41.57 48.67 71.80 67.31 72.58 0.72 0.76 0.99 0.43 0.66 0.88 0.78 1.04 0.95 FAMS−multi 20
21 SAM−T08−human 46.60 37.96 50.87 41.37 36.41 48.94 71.47 68.48 62.90 0.77 0.72 0.98 0.28 0.44 1.21 0.82 1.21 0.28 46.60 39.61 51.98 45.83 40.38 50.86 71.47 68.48 65.41 0.61 0.73 0.96 0.43 0.52 1.16 0.75 1.14 0.31 SAM−T08−human 21
22 Zhang 46.30 38.79 51.70 46.43 37.50 48.59 68.27 55.66 70.30 0.74 0.81 1.07 0.84 0.57 1.17 0.60 0.27 0.86 48.30 40.12 52.33 47.02 41.67 49.52 69.87 62.50 71.94 0.78 0.79 1.00 0.57 0.68 0.99 0.62 0.61 0.90 Zhang 22
23 MULTICOM−CLUSTER 46.30 36.93 46.76 44.64 32.54 42.22 66.03 60.04 64.88 0.74 0.61 0.55 0.64 -0.05 0.41 0.45 0.59 0.43 46.30 36.93 47.03 44.64 32.54 44.31 66.03 60.04 64.88 0.58 0.39 0.38 0.30 -0.45 0.32 0.31 0.40 0.27 MULTICOM−CLUSTER 23
24 keasar−server 45.99 35.91 45.72 48.81 39.48 39.07 68.27 62.50 63.90 0.71 0.49 0.45 1.10 0.82 0.03 0.60 0.77 0.36 46.14 40.28 46.20 48.81 41.77 40.10 69.87 63.25 68.66 0.56 0.81 0.28 0.77 0.69 -0.22 0.62 0.68 0.60 keasar−server 24
25 Jones−UCL 45.52 35.34 49.71 44.64 39.29 43.86 70.19 60.36 71.98 0.67 0.43 0.86 0.64 0.80 0.60 0.73 0.62 0.99 46.45 35.34 49.71 44.64 39.29 43.86 70.19 62.07 71.98 0.59 0.19 0.69 0.30 0.38 0.26 0.65 0.57 0.90 Jones−UCL 25
26 Chicken_George 45.22 41.00 46.66 38.39 33.43 42.93 66.35 56.30 66.68 0.64 1.06 0.54 -0.05 0.06 0.49 0.47 0.32 0.57 49.69 41.77 50.76 51.19 42.66 52.64 69.23 62.18 69.76 0.93 1.00 0.82 1.04 0.80 1.39 0.57 0.58 0.70 Chicken_George 26
27 SAM−T08−server 45.22 38.73 47.72 39.58 35.02 41.85 71.47 68.48 63.85 0.64 0.81 0.65 0.08 0.26 0.36 0.82 1.21 0.35 45.22 38.73 47.72 41.67 38.29 41.85 71.47 68.48 63.85 0.47 0.61 0.46 -0.04 0.26 0.00 0.75 1.14 0.17 SAM−T08−server 27
28 taylor 45.22 38.53 41.38 42.56 38.00 40.82 65.70 58.01 59.40 0.64 0.79 -0.00 0.41 0.63 0.24 0.43 0.44 0.00 45.22 39.30 41.71 47.02 42.76 41.43 69.55 61.86 62.30 0.47 0.69 -0.25 0.57 0.81 -0.05 0.60 0.56 0.04 taylor 28
29 ABIpro 45.06 36.21 49.59 39.88 37.10 42.38 70.51 65.81 73.32 0.63 0.52 0.85 0.11 0.52 0.43 0.75 1.02 1.09 45.37 36.37 49.59 41.96 37.10 42.38 70.51 65.81 73.32 0.48 0.32 0.68 -0.00 0.11 0.07 0.67 0.90 1.02 ABIpro 29
30 3D−JIGSAW_V3 44.91 37.50 44.30 45.24 34.72 34.02 68.59 63.25 68.78 0.61 0.67 0.30 0.70 0.22 -0.58 0.62 0.83 0.74 44.91 37.50 44.30 45.54 35.22 34.18 69.23 63.46 68.79 0.44 0.46 0.06 0.40 -0.12 -0.98 0.57 0.70 0.62 3D−JIGSAW_V3 30
31 Pcons_dot_net 44.75 36.83 40.45 42.26 37.30 31.22 66.03 60.90 63.26 0.60 0.59 -0.10 0.38 0.55 -0.91 0.45 0.66 0.31 44.75 36.83 48.90 50.00 44.84 46.17 66.03 60.90 66.63 0.42 0.38 0.60 0.90 1.07 0.56 0.31 0.47 0.42 Pcons_dot_net 31
32 Pcons_multi 44.75 36.83 40.45 42.26 37.30 31.22 66.03 60.90 63.26 0.60 0.59 -0.10 0.38 0.55 -0.91 0.45 0.66 0.31 44.75 36.83 40.45 42.26 37.30 31.22 66.03 60.90 64.45 0.42 0.38 -0.40 0.03 0.14 -1.36 0.31 0.47 0.23 Pcons_multi 32
33 BAKER−ROBETTA 44.75 36.01 50.17 43.45 38.89 44.42 68.59 63.03 70.54 0.60 0.50 0.91 0.51 0.75 0.67 0.62 0.81 0.88 49.69 40.74 53.57 55.66 52.68 49.89 68.59 63.25 71.48 0.93 0.87 1.15 1.54 2.03 1.04 0.52 0.68 0.86 BAKER−ROBETTA 33
34 MUSTER 44.60 34.93 50.23 45.54 41.77 43.19 70.19 63.78 71.94 0.58 0.38 0.91 0.74 1.11 0.52 0.73 0.87 0.99 44.60 36.27 50.23 45.54 41.77 43.19 70.19 63.78 71.94 0.40 0.31 0.76 0.40 0.69 0.17 0.65 0.73 0.90 MUSTER 34
35 MUProt 44.60 34.21 47.37 49.70 41.96 43.51 65.39 58.33 64.07 0.58 0.30 0.62 1.20 1.13 0.56 0.41 0.47 0.37 44.60 34.21 47.37 49.70 41.96 44.10 65.39 58.76 65.06 0.40 0.05 0.42 0.87 0.71 0.29 0.26 0.28 0.28 MUProt 35
36 Bates_BMM 44.44 37.14 46.80 43.16 40.38 45.01 66.99 55.13 64.18 0.57 0.63 0.56 0.47 0.93 0.74 0.51 0.23 0.38 44.44 37.76 46.80 43.45 40.38 45.22 66.99 55.13 64.18 0.39 0.49 0.35 0.16 0.52 0.44 0.39 -0.04 0.20 Bates_BMM 36
37 nFOLD3 44.29 37.60 41.98 40.77 29.27 33.97 66.67 60.90 64.16 0.56 0.68 0.06 0.21 -0.46 -0.58 0.49 0.66 0.38 44.29 37.60 41.98 40.77 32.44 33.97 66.67 60.90 64.16 0.37 0.47 -0.22 -0.14 -0.46 -1.01 0.36 0.47 0.20 nFOLD3 37
38 PSI 44.29 36.06 42.84 46.73 40.97 37.26 63.78 58.01 62.30 0.56 0.51 0.15 0.87 1.01 -0.19 0.30 0.44 0.23 44.29 36.06 42.84 46.73 40.97 42.48 63.78 58.01 62.30 0.37 0.28 -0.12 0.53 0.59 0.08 0.13 0.22 0.04 PSI 38
39 Zhang−Server 44.14 39.09 47.66 35.12 33.73 39.88 69.55 56.30 69.16 0.54 0.85 0.65 -0.41 0.10 0.13 0.69 0.32 0.77 46.60 41.36 48.81 41.07 35.32 44.18 69.55 60.47 69.22 0.61 0.94 0.59 -0.11 -0.11 0.30 0.60 0.43 0.65 Zhang−Server 39
40 ACOMPMOD 44.14 36.73 46.94 46.13 39.98 41.46 66.35 47.44 65.01 0.54 0.58 0.57 0.80 0.88 0.32 0.47 -0.33 0.44 44.14 36.73 46.94 46.13 39.98 41.46 66.35 47.44 65.01 0.36 0.36 0.37 0.47 0.47 -0.05 0.33 -0.71 0.28 ACOMPMOD 40
41 MULTICOM 43.98 36.06 47.93 43.75 36.41 47.44 67.31 54.49 64.07 0.53 0.51 0.68 0.54 0.44 1.03 0.54 0.18 0.37 49.54 41.46 54.67 55.95 52.58 52.34 71.80 61.97 73.28 0.91 0.96 1.28 1.57 2.02 1.35 0.78 0.57 1.02 MULTICOM 41
42 3DShotMQ 43.83 35.39 48.68 39.29 31.35 41.40 68.59 63.03 72.54 0.51 0.43 0.75 0.05 -0.20 0.31 0.62 0.81 1.03 43.83 35.39 48.68 39.29 31.35 41.40 68.59 63.03 72.54 0.32 0.20 0.57 -0.31 -0.60 -0.06 0.52 0.66 0.95 3DShotMQ 42
43 Zico 43.83 34.88 48.83 42.26 38.89 45.11 66.99 60.15 69.04 0.51 0.38 0.77 0.38 0.75 0.75 0.51 0.60 0.76 49.23 40.90 53.68 55.95 52.78 51.61 67.95 61.54 71.46 0.88 0.89 1.16 1.57 2.04 1.26 0.47 0.53 0.85 Zico 43
44 ZicoFullSTP 43.83 34.88 48.83 42.26 38.89 45.11 66.99 60.15 69.04 0.51 0.38 0.77 0.38 0.75 0.75 0.51 0.60 0.76 44.44 38.89 48.83 42.26 38.89 46.16 66.99 60.15 69.04 0.39 0.63 0.59 0.03 0.33 0.56 0.39 0.41 0.64 ZicoFullSTP 44
45 mufold 43.67 37.40 48.47 41.96 39.58 44.61 66.99 59.08 68.81 0.50 0.66 0.73 0.34 0.83 0.69 0.51 0.52 0.74 48.92 43.16 52.12 45.24 40.87 51.09 67.95 60.26 69.33 0.85 1.17 0.98 0.37 0.58 1.19 0.47 0.42 0.66 mufold 45
46 FALCON_CONSENSUS 43.36 32.36 50.04 49.70 39.38 49.85 66.35 59.51 63.79 0.47 0.09 0.89 1.20 0.81 1.32 0.47 0.55 0.35 45.22 34.98 50.52 56.55 48.41 57.10 66.35 59.51 63.79 0.47 0.14 0.79 1.64 1.51 1.96 0.33 0.35 0.17 FALCON_CONSENSUS 46
47 FALCON 43.36 32.36 50.04 49.70 39.38 49.85 66.35 59.51 63.79 0.47 0.09 0.89 1.20 0.81 1.32 0.47 0.55 0.35 45.22 34.98 50.52 56.55 48.41 57.10 66.35 59.51 63.79 0.47 0.14 0.79 1.64 1.51 1.96 0.33 0.35 0.17 FALCON 47
48 SAM−T06−server 43.21 38.27 42.74 41.07 36.31 36.33 65.39 57.91 63.16 0.46 0.76 0.14 0.24 0.42 -0.30 0.41 0.44 0.30 43.21 38.27 42.74 41.07 36.31 36.33 66.03 60.47 63.36 0.26 0.56 -0.13 -0.11 0.02 -0.71 0.31 0.43 0.13 SAM−T06−server 48
49 TASSER 43.06 37.50 44.07 34.82 30.85 37.47 66.99 61.86 66.21 0.44 0.67 0.28 -0.44 -0.26 -0.16 0.51 0.73 0.54 47.07 40.79 49.82 44.05 36.01 47.83 66.99 61.86 67.99 0.66 0.87 0.71 0.23 -0.02 0.77 0.39 0.56 0.54 TASSER 49
50 MidwayFolding 43.06 32.87 48.70 49.41 36.71 47.73 66.35 57.37 66.00 0.44 0.15 0.76 1.16 0.47 1.07 0.47 0.40 0.52 43.06 37.60 49.01 52.08 38.39 48.33 66.35 57.37 66.01 0.25 0.47 0.61 1.14 0.27 0.83 0.33 0.16 0.37 MidwayFolding 50
51 LEE 42.90 34.36 50.35 45.83 43.25 43.51 70.19 65.06 72.21 0.43 0.32 0.93 0.77 1.29 0.56 0.73 0.96 1.01 42.90 34.93 50.62 45.83 43.25 43.51 70.51 65.06 72.30 0.23 0.14 0.80 0.43 0.87 0.22 0.67 0.84 0.93 LEE 51
52 PRI−Yang−KiharA 42.59 33.23 49.32 50.59 44.44 48.65 65.39 58.76 66.74 0.40 0.19 0.82 1.29 1.44 1.18 0.41 0.50 0.58 42.59 33.23 49.32 50.59 44.44 48.65 65.39 58.76 66.74 0.20 -0.08 0.65 0.97 1.02 0.88 0.26 0.28 0.43 PRI−Yang−KiharA 52
53 PS2−server 42.59 32.92 46.84 41.37 33.13 41.92 66.03 55.77 65.63 0.40 0.16 0.56 0.28 0.03 0.37 0.45 0.28 0.49 42.59 32.92 46.84 42.26 35.12 42.18 66.03 55.77 65.63 0.20 -0.11 0.36 0.03 -0.13 0.04 0.31 0.02 0.33 PS2−server 53
54 SAMUDRALA 42.13 32.46 47.67 44.34 42.56 38.83 69.87 66.03 72.50 0.36 0.10 0.65 0.60 1.21 0.00 0.71 1.03 1.03 43.98 39.04 50.37 46.13 42.76 44.37 71.15 66.03 73.28 0.34 0.65 0.77 0.47 0.81 0.33 0.73 0.92 1.02 SAMUDRALA 54
55 RAPTOR 42.13 32.36 47.80 47.62 34.33 44.27 66.35 57.37 66.00 0.36 0.09 0.66 0.97 0.18 0.65 0.47 0.40 0.52 42.13 32.36 47.80 47.62 34.33 44.27 66.35 57.37 66.00 0.15 -0.18 0.47 0.63 -0.23 0.31 0.33 0.16 0.37 RAPTOR 55
56 FAMSD 41.98 35.49 39.68 38.69 35.32 36.63 62.82 57.91 56.73 0.35 0.44 -0.18 -0.02 0.30 -0.26 0.23 0.44 -0.21 43.21 35.55 40.31 44.94 38.39 36.87 62.82 57.91 56.79 0.26 0.22 -0.41 0.33 0.27 -0.64 0.05 0.21 -0.46 FAMSD 56
57 FFASsuboptimal 41.98 33.33 40.86 36.31 30.36 26.17 69.23 63.25 70.07 0.35 0.20 -0.06 -0.28 -0.32 -1.51 0.67 0.83 0.84 41.98 35.44 42.67 37.20 31.75 28.56 69.87 64.10 70.85 0.14 0.20 -0.14 -0.54 -0.55 -1.71 0.62 0.75 0.80 FFASsuboptimal 57
58 LevittGroup 41.67 35.80 44.67 45.54 38.99 48.14 59.30 49.04 57.14 0.32 0.48 0.34 0.74 0.76 1.12 -0.01 -0.22 -0.17 42.13 35.80 44.67 46.13 42.76 48.14 59.94 51.39 57.29 0.15 0.25 0.10 0.47 0.81 0.81 -0.19 -0.36 -0.41 LevittGroup 58
59 McGuffin 41.67 34.36 44.40 38.99 27.08 40.84 64.74 55.56 64.62 0.32 0.32 0.31 0.01 -0.73 0.24 0.36 0.26 0.41 41.67 34.47 44.68 39.29 29.17 41.39 64.74 55.56 64.62 0.10 0.08 0.10 -0.31 -0.86 -0.06 0.20 0.00 0.24 McGuffin 59
60 Jiang_Zhu 41.67 34.36 44.40 38.99 27.08 40.84 64.74 55.56 64.62 0.32 0.32 0.31 0.01 -0.73 0.24 0.36 0.26 0.41 41.67 34.47 44.68 39.29 29.17 41.39 64.74 55.56 64.62 0.10 0.08 0.10 -0.31 -0.86 -0.06 0.20 0.00 0.24 Jiang_Zhu 60
61 A−TASSER 41.51 37.19 39.14 37.20 31.55 36.45 62.18 52.99 57.48 0.30 0.63 -0.23 -0.18 -0.17 -0.28 0.19 0.07 -0.15 41.51 37.19 39.14 38.39 32.64 39.66 63.46 60.68 57.48 0.09 0.42 -0.55 -0.41 -0.44 -0.28 0.10 0.45 -0.40 A−TASSER 61
62 GS−MetaServer2 41.51 33.90 36.49 40.18 30.85 31.91 60.58 55.23 55.27 0.30 0.27 -0.51 0.15 -0.26 -0.83 0.08 0.24 -0.32 44.60 36.83 44.15 44.64 42.06 36.05 69.23 64.10 68.63 0.40 0.38 0.04 0.30 0.72 -0.74 0.57 0.75 0.60 GS−MetaServer2 62
63 Kolinski 41.36 32.82 39.70 35.12 31.35 35.26 63.14 56.73 60.44 0.29 0.14 -0.18 -0.41 -0.20 -0.43 0.25 0.35 0.08 41.36 32.82 39.70 35.12 31.35 35.26 66.03 58.33 64.80 0.07 -0.13 -0.49 -0.78 -0.60 -0.84 0.31 0.25 0.26 Kolinski 63
64 MULTICOM−RANK 41.20 36.68 38.33 37.20 30.26 31.89 62.82 50.21 58.26 0.28 0.58 -0.32 -0.18 -0.33 -0.83 0.23 -0.13 -0.09 43.06 36.68 44.64 45.54 35.22 38.45 65.70 57.37 64.89 0.25 0.36 0.10 0.40 -0.12 -0.43 0.28 0.16 0.27 MULTICOM−RANK 64
65 Frankenstein 41.05 34.16 44.26 34.52 24.60 32.35 69.23 62.39 70.77 0.26 0.29 0.30 -0.48 -1.04 -0.77 0.67 0.76 0.89 42.13 35.34 44.26 36.31 33.53 33.56 69.23 62.39 70.77 0.15 0.19 0.05 -0.64 -0.33 -1.06 0.57 0.60 0.79 Frankenstein 65
66 pro−sp3−TASSER 40.90 35.55 40.34 36.61 30.85 39.04 62.18 49.57 56.26 0.25 0.45 -0.11 -0.25 -0.26 0.03 0.19 -0.18 -0.24 42.59 35.55 45.46 39.58 36.01 40.04 63.46 59.62 63.75 0.20 0.22 0.19 -0.27 -0.02 -0.23 0.10 0.36 0.16 pro−sp3−TASSER 66
67 SAM−T02−server 40.90 31.94 40.21 43.75 38.79 38.26 60.26 52.78 56.17 0.25 0.04 -0.12 0.54 0.73 -0.07 0.06 0.06 -0.25 43.21 36.93 41.45 43.75 39.68 38.26 62.18 57.48 58.79 0.26 0.39 -0.28 0.20 0.43 -0.46 -0.01 0.17 -0.28 SAM−T02−server 67
68 FFASstandard 40.90 31.02 42.67 37.20 30.06 28.56 69.23 56.62 70.85 0.25 -0.06 0.13 -0.18 -0.36 -1.23 0.67 0.34 0.90 42.28 35.60 42.67 37.20 31.45 28.56 70.51 61.33 70.85 0.17 0.22 -0.14 -0.54 -0.58 -1.71 0.67 0.51 0.80 FFASstandard 68
69 FFASflextemplate 40.90 31.02 42.67 37.20 30.06 28.56 69.23 56.62 70.85 0.25 -0.06 0.13 -0.18 -0.36 -1.23 0.67 0.34 0.90 42.28 35.60 42.67 37.20 31.45 28.56 70.51 61.33 70.85 0.17 0.22 -0.14 -0.54 -0.58 -1.71 0.67 0.51 0.80 FFASflextemplate 69
70 LEE−SERVER 40.59 35.85 49.19 42.56 38.79 40.22 70.19 65.49 71.85 0.22 0.48 0.81 0.41 0.73 0.17 0.73 0.99 0.98 41.98 36.11 50.12 45.83 41.17 41.93 70.51 65.49 72.09 0.14 0.29 0.74 0.43 0.61 0.01 0.67 0.88 0.91 LEE−SERVER 70
71 EB_AMU_Physics 40.59 31.53 43.22 36.31 30.56 31.23 69.87 64.10 71.40 0.22 -0.00 0.19 -0.28 -0.30 -0.91 0.71 0.89 0.94 40.59 31.53 43.22 36.31 30.56 31.23 69.87 64.10 71.40 -0.01 -0.29 -0.07 -0.64 -0.69 -1.36 0.62 0.75 0.85 EB_AMU_Physics 71
72 CpHModels 40.28 34.10 40.83 33.63 29.27 28.43 67.63 62.07 66.94 0.19 0.29 -0.06 -0.58 -0.46 -1.24 0.56 0.74 0.59 40.28 34.10 40.83 33.63 29.27 28.43 67.63 62.07 66.94 -0.04 0.03 -0.35 -0.95 -0.85 -1.72 0.44 0.57 0.45 CpHModels 72
73 AMU−Biology 39.97 32.15 42.42 43.75 39.58 46.09 57.37 54.27 54.80 0.16 0.07 0.11 0.54 0.83 0.87 -0.14 0.17 -0.36 39.97 32.15 44.17 43.75 39.58 49.53 57.37 54.27 54.80 -0.07 -0.21 0.04 0.20 0.42 0.99 -0.40 -0.11 -0.64 AMU−Biology 73
74 3DShot2 39.81 32.92 38.17 34.52 29.17 32.12 61.54 52.35 58.64 0.15 0.16 -0.33 -0.48 -0.47 -0.80 0.14 0.03 -0.06 39.81 32.92 38.17 34.52 29.17 32.12 61.54 52.35 58.64 -0.09 -0.11 -0.67 -0.85 -0.86 -1.25 -0.06 -0.28 -0.29 3DShot2 74
75 FUGUE_KM 39.51 33.64 35.28 34.23 29.07 25.19 61.86 56.09 59.17 0.12 0.24 -0.63 -0.51 -0.48 -1.63 0.17 0.30 -0.02 39.51 33.64 35.28 34.23 29.07 25.19 61.86 56.09 59.17 -0.12 -0.02 -1.01 -0.88 -0.88 -2.14 -0.03 0.05 -0.24 FUGUE_KM 75
76 CBSU 39.20 36.42 43.04 32.14 28.18 31.31 69.55 64.64 71.13 0.09 0.55 0.17 -0.74 -0.59 -0.90 0.69 0.93 0.92 39.20 36.57 43.62 33.63 31.45 32.41 69.55 64.64 71.26 -0.15 0.34 -0.02 -0.95 -0.58 -1.21 0.60 0.80 0.84 CBSU 76
77 GS−KudlatyPred 39.20 33.64 38.26 40.48 39.29 36.22 58.01 50.32 54.74 0.09 0.24 -0.33 0.18 0.80 -0.31 -0.09 -0.12 -0.36 39.20 33.64 38.26 40.48 39.29 36.22 58.01 50.32 54.74 -0.15 -0.02 -0.66 -0.17 0.38 -0.72 -0.35 -0.46 -0.64 GS−KudlatyPred 77
78 GeneSilicoMetaServer 39.20 30.14 35.68 34.52 27.38 26.04 62.18 57.27 59.16 0.09 -0.16 -0.59 -0.48 -0.69 -1.53 0.19 0.39 -0.02 48.15 36.83 46.62 48.21 42.06 39.85 69.23 64.10 68.63 0.77 0.38 0.33 0.70 0.72 -0.25 0.57 0.75 0.60 GeneSilicoMetaServer 78
79 JIVE08 39.04 33.59 36.30 41.37 35.62 34.63 60.26 55.13 53.85 0.08 0.23 -0.53 0.28 0.34 -0.50 0.06 0.23 -0.43 39.04 33.59 36.30 41.37 35.62 41.55 60.26 55.13 53.85 -0.17 -0.03 -0.89 -0.07 -0.07 -0.04 -0.16 -0.04 -0.72 JIVE08 79
80 PS2−manual 39.04 31.12 36.65 41.37 33.13 35.38 59.30 49.47 54.00 0.08 -0.05 -0.49 0.28 0.03 -0.41 -0.01 -0.18 -0.42 42.13 35.34 42.61 41.37 33.13 36.23 66.03 57.69 65.58 0.15 0.19 -0.14 -0.07 -0.38 -0.72 0.31 0.19 0.33 PS2−manual 80
81 Pcons_local 38.58 29.01 38.96 37.20 29.46 28.07 64.10 60.26 63.72 0.04 -0.28 -0.25 -0.18 -0.43 -1.29 0.32 0.61 0.34 44.44 34.47 48.90 50.00 44.84 46.17 64.74 60.26 66.63 0.39 0.08 0.60 0.90 1.07 0.56 0.20 0.42 0.42 Pcons_local 81
82 Bilab−UT 38.27 32.61 44.70 40.48 34.92 42.01 64.74 54.91 63.03 0.01 0.12 0.34 0.18 0.25 0.38 0.36 0.22 0.29 39.04 33.08 48.26 44.64 42.56 47.93 64.74 54.91 63.03 -0.17 -0.09 0.52 0.30 0.79 0.78 0.20 -0.05 0.10 Bilab−UT 82
83 MULTICOM−REFINE 37.96 29.94 37.96 37.20 32.04 30.57 62.50 55.66 58.67 -0.02 -0.18 -0.36 -0.18 -0.11 -0.99 0.21 0.27 -0.05 44.14 33.85 47.12 50.00 45.24 44.10 65.39 58.76 64.04 0.36 0.00 0.39 0.90 1.12 0.29 0.26 0.28 0.19 MULTICOM−REFINE 83
84 SMEG−CCP 37.81 32.36 44.83 24.41 19.64 41.82 64.10 51.07 61.80 -0.03 0.09 0.35 -1.59 -1.66 0.36 0.32 -0.07 0.19 37.81 32.36 44.83 24.41 19.64 41.82 64.10 51.07 61.80 -0.29 -0.18 0.12 -1.99 -2.04 -0.00 0.15 -0.39 -0.01 SMEG−CCP 84
85 MULTICOM−CMFR 37.19 30.09 37.54 35.71 30.56 29.97 62.82 51.28 58.48 -0.09 -0.16 -0.40 -0.35 -0.30 -1.06 0.23 -0.05 -0.07 44.44 34.05 47.27 50.00 42.06 43.81 65.06 58.23 63.57 0.39 0.03 0.41 0.90 0.72 0.25 0.23 0.24 0.15 MULTICOM−CMFR 85
86 3D−JIGSAW_AEP 36.27 32.25 44.31 44.05 32.94 33.87 70.19 63.78 69.67 -0.17 0.08 0.30 0.57 0.00 -0.59 0.73 0.87 0.81 45.83 35.75 44.69 45.24 32.94 33.93 70.19 65.49 69.89 0.53 0.24 0.10 0.37 -0.40 -1.02 0.65 0.88 0.71 3D−JIGSAW_AEP 86
87 COMA−M 34.57 31.28 33.06 33.93 27.18 30.57 53.85 49.15 50.62 -0.33 -0.03 -0.86 -0.54 -0.72 -0.99 -0.38 -0.21 -0.69 34.72 31.28 35.34 35.12 27.78 34.68 54.81 51.82 50.88 -0.61 -0.32 -1.00 -0.78 -1.04 -0.92 -0.61 -0.33 -0.99 COMA−M 87
88 StruPPi 33.49 25.98 38.89 38.39 32.84 36.66 56.41 40.06 56.42 -0.43 -0.62 -0.26 -0.05 -0.01 -0.26 -0.20 -0.87 -0.23 34.41 25.98 38.89 38.39 32.84 36.66 58.97 50.21 56.42 -0.64 -0.99 -0.58 -0.41 -0.41 -0.66 -0.27 -0.47 -0.49 StruPPi 88
89 3Dpro 33.02 30.76 26.66 16.07 14.19 16.11 58.65 50.75 51.31 -0.47 -0.09 -1.53 -2.51 -2.35 -2.72 -0.05 -0.09 -0.63 33.02 30.76 31.95 27.08 25.30 25.29 59.30 54.81 51.31 -0.78 -0.39 -1.40 -1.69 -1.34 -2.13 -0.24 -0.06 -0.95 3Dpro 89
90 FOLDpro 32.87 26.80 31.95 23.81 19.05 24.91 59.30 54.81 51.16 -0.48 -0.53 -0.98 -1.66 -1.74 -1.67 -0.01 0.21 -0.64 32.87 26.80 31.95 23.81 19.05 24.91 59.30 54.81 51.16 -0.80 -0.88 -1.40 -2.05 -2.11 -2.18 -0.24 -0.06 -0.96 FOLDpro 90
91 METATASSER 32.72 28.50 35.15 28.57 23.21 33.31 59.62 52.35 52.17 -0.50 -0.34 -0.65 -1.13 -1.22 -0.66 0.01 0.03 -0.56 46.14 37.60 41.99 43.75 38.39 35.88 66.67 61.75 61.60 0.56 0.47 -0.22 0.20 0.27 -0.77 0.36 0.55 -0.03 METATASSER 91
92 Softberry 32.56 25.67 36.27 23.51 21.13 28.27 67.95 53.63 62.56 -0.51 -0.66 -0.53 -1.69 -1.48 -1.26 0.58 0.12 0.25 32.56 25.67 36.27 23.51 21.13 28.27 67.95 53.63 62.56 -0.83 -1.02 -0.89 -2.09 -1.85 -1.74 0.47 -0.17 0.06 Softberry 92
93 FEIG 25.93 20.27 29.59 23.51 20.54 30.54 45.51 32.27 44.23 -1.12 -1.27 -1.22 -1.69 -1.55 -0.99 -0.94 -1.45 -1.19 25.93 23.46 29.59 23.51 21.03 31.12 47.12 42.20 44.39 -1.51 -1.30 -1.68 -2.09 -1.87 -1.38 -1.24 -1.17 -1.57 FEIG 93
94 panther_server 24.23 21.25 7.52 3.57 3.57 -10.64 50.32 44.12 40.50 -1.27 -1.16 -3.51 -3.89 -3.68 -5.92 -0.62 -0.58 -1.48 24.23 21.25 7.52 3.57 3.57 -10.64 50.32 44.12 40.50 -1.68 -1.58 -4.28 -4.34 -4.02 -6.74 -0.97 -1.00 -1.91 panther_server 94
95 COMA 21.76 17.85 16.83 20.24 16.27 11.82 45.19 37.07 37.21 -1.49 -1.54 -2.54 -2.05 -2.09 -3.23 -0.96 -1.09 -1.74 34.72 31.28 35.34 35.12 27.78 34.68 54.81 51.82 50.88 -0.61 -0.32 -1.00 -0.78 -1.04 -0.92 -0.61 -0.33 -0.99 COMA 95
96 POEMQA 20.22 17.80 36.23 35.71 30.95 46.80 31.41 24.57 43.02 -1.63 -1.54 -0.54 -0.35 -0.25 0.96 -1.90 -2.01 -1.28 41.36 36.63 38.87 36.61 32.04 46.80 65.06 58.55 59.18 0.07 0.35 -0.58 -0.61 -0.51 0.64 0.23 0.27 -0.24 POEMQA 96
97 POEM 20.22 17.80 36.23 35.71 30.95 46.80 31.41 24.57 43.02 -1.63 -1.54 -0.54 -0.35 -0.25 0.96 -1.90 -2.01 -1.28 41.36 36.63 38.87 36.61 32.04 46.80 65.06 58.55 59.18 0.07 0.35 -0.58 -0.61 -0.51 0.64 0.23 0.27 -0.24 POEM 97
98 MUFOLD−MD 18.98 17.03 29.66 30.95 29.17 42.77 22.44 19.66 29.83 -1.75 -1.63 -1.22 -0.87 -0.47 0.47 -2.51 -2.37 -2.32 18.98 17.03 31.30 30.95 29.17 42.77 30.13 27.46 38.23 -2.22 -2.11 -1.48 -1.25 -0.86 0.12 -2.62 -2.47 -2.12 MUFOLD−MD 98
99 fleil 17.75 14.87 22.45 26.19 22.62 30.54 34.94 28.95 31.79 -1.86 -1.87 -1.96 -1.40 -1.29 -0.99 -1.66 -1.69 -2.16 18.52 16.36 25.38 26.19 22.62 31.22 37.18 32.69 36.46 -2.27 -2.19 -2.17 -1.79 -1.67 -1.36 -2.05 -2.01 -2.27 fleil 99
100 SAINT1 17.28 14.46 31.19 31.25 25.79 43.38 29.17 24.79 36.56 -1.90 -1.92 -1.06 -0.84 -0.89 0.55 -2.05 -1.99 -1.79 17.28 14.46 31.19 31.25 25.79 43.38 29.17 24.79 36.56 -2.40 -2.43 -1.49 -1.21 -1.28 0.20 -2.70 -2.70 -2.27 SAINT1 100
101 BioSerf 17.28 14.10 26.45 25.30 21.93 34.61 31.73 26.82 32.92 -1.90 -1.96 -1.55 -1.49 -1.38 -0.50 -1.88 -1.85 -2.07 17.28 14.10 26.45 25.30 21.93 34.61 31.73 26.82 32.92 -2.40 -2.48 -2.05 -1.89 -1.76 -0.93 -2.49 -2.52 -2.59 BioSerf 101
102 Zhou−SPARKS 16.36 12.60 39.62 28.57 20.04 46.42 31.73 27.67 50.56 -1.99 -2.13 -0.18 -1.13 -1.61 0.91 -1.88 -1.78 -0.69 16.36 12.60 39.62 28.57 20.04 46.42 31.73 27.67 50.56 -2.49 -2.67 -0.50 -1.52 -1.99 0.59 -2.49 -2.45 -1.01 Zhou−SPARKS 102
103 Wolynes 16.20 13.27 23.38 28.87 23.91 32.48 28.85 25.21 31.70 -2.00 -2.05 -1.87 -1.10 -1.13 -0.76 -2.07 -1.96 -2.17 16.20 13.68 26.70 28.87 23.91 40.50 28.85 25.21 33.68 -2.51 -2.53 -2.02 -1.48 -1.51 -0.17 -2.73 -2.66 -2.52 Wolynes 103
104 ZicoFullSTPFullData 16.05 14.61 30.24 27.68 24.90 41.72 28.20 25.75 36.21 -2.01 -1.90 -1.16 -1.23 -1.01 0.35 -2.12 -1.92 -1.81 43.83 34.88 48.83 42.26 38.89 45.11 66.99 60.15 69.04 0.32 0.13 0.59 0.03 0.33 0.42 0.39 0.41 0.64 ZicoFullSTPFullData 104
105 Handl−Lovell 15.59 14.51 26.94 23.81 20.83 32.23 30.13 27.14 38.32 -2.06 -1.91 -1.50 -1.66 -1.52 -0.79 -1.99 -1.82 -1.65 18.52 17.18 33.72 27.98 26.19 40.54 36.54 32.91 43.97 -2.27 -2.09 -1.19 -1.58 -1.23 -0.17 -2.10 -1.99 -1.60 Handl−Lovell 105
106 keasar 15.28 13.79 31.11 27.38 24.41 40.76 25.32 22.33 38.95 -2.08 -1.99 -1.07 -1.27 -1.07 0.23 -2.31 -2.18 -1.60 45.83 36.57 46.95 42.86 39.09 47.50 69.23 64.32 63.87 0.53 0.34 0.37 0.10 0.36 0.73 0.57 0.77 0.18 keasar 106
107 rehtnap 14.51 13.89 -4.27 4.46 4.27 -10.08 29.49 28.20 16.05 -2.15 -1.98 -4.73 -3.79 -3.59 -5.86 -2.03 -1.74 -3.40 14.97 14.25 -4.27 4.46 4.46 -10.08 30.77 29.27 16.05 -2.63 -2.46 -5.67 -4.24 -3.91 -6.67 -2.57 -2.31 -4.10 rehtnap 107
108 RBO−Proteus 14.51 13.37 29.35 24.70 22.12 37.64 24.04 21.15 36.62 -2.15 -2.04 -1.25 -1.56 -1.35 -0.14 -2.40 -2.26 -1.78 20.52 17.95 36.22 36.01 30.85 45.30 31.09 28.53 42.84 -2.06 -1.99 -0.90 -0.68 -0.66 0.45 -2.54 -2.37 -1.70 RBO−Proteus 108
109 Distill 14.20 12.71 18.70 23.81 19.54 24.38 21.80 14.96 27.84 -2.18 -2.12 -2.35 -1.66 -1.68 -1.73 -2.55 -2.72 -2.47 14.20 12.71 23.18 23.81 20.73 30.88 25.00 21.15 31.44 -2.71 -2.65 -2.43 -2.05 -1.90 -1.41 -3.04 -3.02 -2.72 Distill 109
110 forecast 13.58 10.49 15.41 19.94 14.78 21.63 18.91 15.92 24.08 -2.24 -2.37 -2.69 -2.09 -2.27 -2.06 -2.75 -2.65 -2.77 16.36 12.76 18.44 24.11 20.34 25.95 20.19 17.52 27.38 -2.49 -2.64 -2.99 -2.02 -1.95 -2.04 -3.43 -3.34 -3.09 forecast 110
111 pipe_int 12.65 11.32 20.73 22.92 20.64 26.20 21.47 17.31 30.60 -2.32 -2.27 -2.14 -1.76 -1.54 -1.51 -2.57 -2.54 -2.25 16.36 15.33 27.12 26.79 23.21 37.37 30.45 25.00 33.03 -2.49 -2.32 -1.97 -1.72 -1.60 -0.57 -2.60 -2.68 -2.58 pipe_int 111
112 MUFOLD−Server 12.65 10.60 20.89 19.34 18.16 22.77 26.60 22.54 34.32 -2.32 -2.35 -2.12 -2.15 -1.85 -1.92 -2.23 -2.16 -1.96 12.65 10.60 20.95 19.34 18.16 22.77 26.60 22.54 34.46 -2.87 -2.92 -2.70 -2.56 -2.22 -2.45 -2.91 -2.90 -2.45 MUFOLD−Server 112
113 MeilerLabRene 12.65 10.60 19.10 22.92 18.75 26.65 21.47 20.83 29.00 -2.32 -2.35 -2.31 -1.76 -1.78 -1.46 -2.57 -2.29 -2.38 12.81 11.16 19.10 22.92 18.75 27.74 24.04 20.83 29.00 -2.85 -2.85 -2.92 -2.15 -2.15 -1.81 -3.12 -3.05 -2.94 MeilerLabRene 113
114 Hao_Kihara 12.65 10.24 19.34 18.16 16.96 25.45 25.00 19.02 30.52 -2.32 -2.39 -2.28 -2.28 -2.00 -1.60 -2.33 -2.42 -2.26 39.20 29.53 44.32 49.11 41.27 45.83 62.50 51.07 58.47 -0.15 -0.54 0.06 0.80 0.63 0.51 0.02 -0.39 -0.31 Hao_Kihara 114
115 RANDOM 12.19 10.18 12.19 20.42 17.18 20.42 21.21 17.98 21.21 -2.37 -2.40 -3.02 -2.03 -1.97 -2.20 -2.59 -2.49 -2.99 12.19 10.18 12.19 20.42 17.18 20.42 21.21 17.98 21.21 -2.92 -2.97 -3.73 -2.44 -2.34 -2.75 -3.35 -3.30 -3.64 RANDOM 115
116 DistillSN 12.19 9.82 16.78 21.13 16.96 24.78 18.59 15.38 25.70 -2.37 -2.44 -2.55 -1.95 -2.00 -1.68 -2.77 -2.69 -2.64 15.28 12.71 20.58 26.19 20.04 31.62 21.80 20.30 26.80 -2.60 -2.65 -2.74 -1.79 -1.99 -1.31 -3.30 -3.10 -3.14 DistillSN 116
117 TWPPLAB 12.04 11.01 16.24 15.48 13.29 20.45 23.40 21.26 29.31 -2.38 -2.31 -2.60 -2.58 -2.46 -2.20 -2.44 -2.25 -2.36 12.04 11.01 16.24 15.48 13.29 20.45 23.40 21.26 29.31 -2.93 -2.86 -3.25 -2.99 -2.82 -2.75 -3.17 -3.01 -2.91 TWPPLAB 117
118 DelCLab 11.11 9.41 17.38 19.64 15.08 23.65 20.51 16.45 28.58 -2.46 -2.49 -2.49 -2.12 -2.24 -1.82 -2.64 -2.61 -2.41 12.50 11.06 17.38 23.81 19.84 26.24 23.40 19.98 28.58 -2.89 -2.86 -3.12 -2.05 -2.01 -2.00 -3.17 -3.12 -2.98 DelCLab 118
119 TJ_Jiang 11.11 8.28 12.68 21.43 15.97 23.08 17.31 13.78 19.46 -2.46 -2.61 -2.97 -1.92 -2.12 -1.88 -2.86 -2.80 -3.13 14.81 12.50 21.80 21.43 18.85 30.36 30.13 25.64 32.28 -2.65 -2.68 -2.60 -2.32 -2.14 -1.47 -2.62 -2.63 -2.65 TJ_Jiang 119
120 LOOPP_Server 10.96 8.90 9.67 20.24 18.06 22.95 16.35 13.14 11.15 -2.48 -2.54 -3.28 -2.05 -1.86 -1.90 -2.92 -2.85 -3.78 13.89 12.91 17.68 22.32 19.25 25.16 24.36 22.44 25.43 -2.74 -2.63 -3.08 -2.22 -2.09 -2.14 -3.09 -2.91 -3.26 LOOPP_Server 120
121 mahmood−torda−server 10.80 8.80 16.35 21.13 17.26 24.28 20.83 17.84 23.41 -2.49 -2.56 -2.59 -1.95 -1.96 -1.74 -2.62 -2.51 -2.82 12.19 10.44 17.15 21.13 17.26 24.28 21.15 17.84 27.73 -2.92 -2.94 -3.15 -2.36 -2.33 -2.26 -3.36 -3.31 -3.06 mahmood−torda−server 121
122 mariner1 10.65 8.08 14.39 18.45 12.00 21.74 22.44 14.85 20.95 -2.51 -2.64 -2.80 -2.25 -2.62 -2.05 -2.51 -2.72 -3.01 13.58 12.55 17.99 24.41 21.73 29.31 22.44 17.95 21.79 -2.78 -2.67 -3.05 -1.99 -1.78 -1.61 -3.25 -3.30 -3.59 mariner1 122
123 Sasaki−Cetin−Sasai 10.49 9.16 -2.78 20.24 17.66 17.08 0.00 0.00 -5.69 -2.52 -2.51 -4.57 -2.05 -1.91 -2.60 -4.03 -3.81 -5.10 13.58 11.01 -1.32 26.19 21.23 19.95 0.00 0.00 -5.69 -2.78 -2.86 -5.32 -1.79 -1.84 -2.81 -5.08 -4.88 -6.04 Sasaki−Cetin−Sasai 123
124 ProtAnG 10.34 8.90 12.08 18.45 15.68 22.79 15.06 13.46 18.43 -2.53 -2.54 -3.04 -2.25 -2.16 -1.92 -3.01 -2.83 -3.21 10.34 8.90 12.08 18.45 15.68 22.79 15.06 13.46 18.43 -3.11 -3.13 -3.74 -2.66 -2.53 -2.45 -3.85 -3.70 -3.89 ProtAnG 124
125 Pushchino 10.34 8.59 3.55 14.58 12.20 10.33 14.74 12.61 8.79 -2.53 -2.58 -3.92 -2.68 -2.60 -3.41 -3.03 -2.89 -3.96 10.34 8.59 3.55 14.58 12.20 10.33 14.74 12.61 8.79 -3.11 -3.17 -4.75 -3.10 -2.95 -4.05 -3.88 -3.77 -4.75 Pushchino 125
126 schenk−torda−server 9.88 8.44 13.52 16.96 13.89 17.08 18.27 15.28 24.88 -2.58 -2.60 -2.89 -2.41 -2.38 -2.60 -2.79 -2.69 -2.70 12.04 10.90 15.99 21.13 16.67 21.71 21.15 20.09 25.44 -2.93 -2.88 -3.28 -2.36 -2.40 -2.59 -3.36 -3.11 -3.26 schenk−torda−server 126
127 psiphifoldings 9.57 7.92 14.49 15.77 14.48 21.82 19.87 16.45 24.30 -2.60 -2.65 -2.79 -2.55 -2.31 -2.04 -2.68 -2.61 -2.75 9.57 7.92 14.49 15.77 14.48 21.82 19.87 16.45 24.30 -3.19 -3.25 -3.46 -2.96 -2.67 -2.57 -3.46 -3.43 -3.36 psiphifoldings 127
128 Abagyan                                                       -2.37 -2.40 -3.02 -2.03 -1.97 -2.20 -2.59 -2.49 -2.99                                                       -2.92 -2.97 -3.73 -2.44 -2.34 -2.75 -3.35 -3.30 -3.64 Abagyan 128
129 BHAGEERATH                                                       -2.37 -2.40 -3.02 -2.03 -1.97 -2.20 -2.59 -2.49 -2.99                                                       -2.92 -2.97 -3.73 -2.44 -2.34 -2.75 -3.35 -3.30 -3.64 BHAGEERATH 129
130 FEIG_REFINE                                                       -2.37 -2.40 -3.02 -2.03 -1.97 -2.20 -2.59 -2.49 -2.99                                                       -2.92 -2.97 -3.73 -2.44 -2.34 -2.75 -3.35 -3.30 -3.64 FEIG_REFINE 130
131 FLOUDAS                                                       -2.37 -2.40 -3.02 -2.03 -1.97 -2.20 -2.59 -2.49 -2.99                                                       -2.92 -2.97 -3.73 -2.44 -2.34 -2.75 -3.35 -3.30 -3.64 FLOUDAS 131
132 Fiser−M4T                                                       -2.37 -2.40 -3.02 -2.03 -1.97 -2.20 -2.59 -2.49 -2.99                                                       -2.92 -2.97 -3.73 -2.44 -2.34 -2.75 -3.35 -3.30 -3.64 Fiser−M4T 132
133 FrankensteinLong                                                       -2.37 -2.40 -3.02 -2.03 -1.97 -2.20 -2.59 -2.49 -2.99                                                       -2.92 -2.97 -3.73 -2.44 -2.34 -2.75 -3.35 -3.30 -3.64 FrankensteinLong 133
134 HCA                                                       -2.37 -2.40 -3.02 -2.03 -1.97 -2.20 -2.59 -2.49 -2.99                                                       -2.92 -2.97 -3.73 -2.44 -2.34 -2.75 -3.35 -3.30 -3.64 HCA 134
135 KudlatyPredHuman                                                       -2.37 -2.40 -3.02 -2.03 -1.97 -2.20 -2.59 -2.49 -2.99                                                       -2.92 -2.97 -3.73 -2.44 -2.34 -2.75 -3.35 -3.30 -3.64 KudlatyPredHuman 135
136 Linnolt−UH−CMB                                                       -2.37 -2.40 -3.02 -2.03 -1.97 -2.20 -2.59 -2.49 -2.99                                                       -2.92 -2.97 -3.73 -2.44 -2.34 -2.75 -3.35 -3.30 -3.64 Linnolt−UH−CMB 136
137 NIM2                                                       -2.37 -2.40 -3.02 -2.03 -1.97 -2.20 -2.59 -2.49 -2.99                                                       -2.92 -2.97 -3.73 -2.44 -2.34 -2.75 -3.35 -3.30 -3.64 NIM2 137
138 Nano_team                                                       -2.37 -2.40 -3.02 -2.03 -1.97 -2.20 -2.59 -2.49 -2.99                                                       -2.92 -2.97 -3.73 -2.44 -2.34 -2.75 -3.35 -3.30 -3.64 Nano_team 138
139 NirBenTal                                                       -2.37 -2.40 -3.02 -2.03 -1.97 -2.20 -2.59 -2.49 -2.99                                                       -2.92 -2.97 -3.73 -2.44 -2.34 -2.75 -3.35 -3.30 -3.64 NirBenTal 139
140 OLGAFS                                                       -2.37 -2.40 -3.02 -2.03 -1.97 -2.20 -2.59 -2.49 -2.99                                                       -2.92 -2.97 -3.73 -2.44 -2.34 -2.75 -3.35 -3.30 -3.64 OLGAFS 140
141 Ozkan−Shell                                                       -2.37 -2.40 -3.02 -2.03 -1.97 -2.20 -2.59 -2.49 -2.99                                                       -2.92 -2.97 -3.73 -2.44 -2.34 -2.75 -3.35 -3.30 -3.64 Ozkan−Shell 141
142 PHAISTOS                                                       -2.37 -2.40 -3.02 -2.03 -1.97 -2.20 -2.59 -2.49 -2.99                                                       -2.92 -2.97 -3.73 -2.44 -2.34 -2.75 -3.35 -3.30 -3.64 PHAISTOS 142
143 POISE                                                       -2.37 -2.40 -3.02 -2.03 -1.97 -2.20 -2.59 -2.49 -2.99                                                       -2.92 -2.97 -3.73 -2.44 -2.34 -2.75 -3.35 -3.30 -3.64 POISE 143
144 PZ−UAM                                                       -2.37 -2.40 -3.02 -2.03 -1.97 -2.20 -2.59 -2.49 -2.99                                                       -2.92 -2.97 -3.73 -2.44 -2.34 -2.75 -3.35 -3.30 -3.64 PZ−UAM 144
145 ProteinShop                                                       -2.37 -2.40 -3.02 -2.03 -1.97 -2.20 -2.59 -2.49 -2.99                                                       -2.92 -2.97 -3.73 -2.44 -2.34 -2.75 -3.35 -3.30 -3.64 ProteinShop 145
146 RPFM                                                       -2.37 -2.40 -3.02 -2.03 -1.97 -2.20 -2.59 -2.49 -2.99                                                       -2.92 -2.97 -3.73 -2.44 -2.34 -2.75 -3.35 -3.30 -3.64 RPFM 146
147 Scheraga                                                       -2.37 -2.40 -3.02 -2.03 -1.97 -2.20 -2.59 -2.49 -2.99                                                       -2.92 -2.97 -3.73 -2.44 -2.34 -2.75 -3.35 -3.30 -3.64 Scheraga 147
148 ShakAbInitio                                                       -2.37 -2.40 -3.02 -2.03 -1.97 -2.20 -2.59 -2.49 -2.99                                                       -2.92 -2.97 -3.73 -2.44 -2.34 -2.75 -3.35 -3.30 -3.64 ShakAbInitio 148
149 TsaiLab                                                       -2.37 -2.40 -3.02 -2.03 -1.97 -2.20 -2.59 -2.49 -2.99                                                       -2.92 -2.97 -3.73 -2.44 -2.34 -2.75 -3.35 -3.30 -3.64 TsaiLab 149
150 UCDavisGenome                                                       -2.37 -2.40 -3.02 -2.03 -1.97 -2.20 -2.59 -2.49 -2.99                                                       -2.92 -2.97 -3.73 -2.44 -2.34 -2.75 -3.35 -3.30 -3.64 UCDavisGenome 150
151 Wolfson−FOBIA                                                       -2.37 -2.40 -3.02 -2.03 -1.97 -2.20 -2.59 -2.49 -2.99                                                       -2.92 -2.97 -3.73 -2.44 -2.34 -2.75 -3.35 -3.30 -3.64 Wolfson−FOBIA 151
152 YASARA                                                       -2.37 -2.40 -3.02 -2.03 -1.97 -2.20 -2.59 -2.49 -2.99                                                       -2.92 -2.97 -3.73 -2.44 -2.34 -2.75 -3.35 -3.30 -3.64 YASARA 152
153 YASARARefine                                                       -2.37 -2.40 -3.02 -2.03 -1.97 -2.20 -2.59 -2.49 -2.99                                                       -2.92 -2.97 -3.73 -2.44 -2.34 -2.75 -3.35 -3.30 -3.64 YASARARefine 153
154 dill_ucsf                                                       -2.37 -2.40 -3.02 -2.03 -1.97 -2.20 -2.59 -2.49 -2.99                                                       -2.92 -2.97 -3.73 -2.44 -2.34 -2.75 -3.35 -3.30 -3.64 dill_ucsf 154
155 dill_ucsf_extended                                                       -2.37 -2.40 -3.02 -2.03 -1.97 -2.20 -2.59 -2.49 -2.99                                                       -2.92 -2.97 -3.73 -2.44 -2.34 -2.75 -3.35 -3.30 -3.64 dill_ucsf_extended 155
156 huber−torda−server                                                       -2.37 -2.40 -3.02 -2.03 -1.97 -2.20 -2.59 -2.49 -2.99                                                       -2.92 -2.97 -3.73 -2.44 -2.34 -2.75 -3.35 -3.30 -3.64 huber−torda−server 156
157 igor                                                       -2.37 -2.40 -3.02 -2.03 -1.97 -2.20 -2.59 -2.49 -2.99                                                       -2.92 -2.97 -3.73 -2.44 -2.34 -2.75 -3.35 -3.30 -3.64 igor 157
158 jacobson                                                       -2.37 -2.40 -3.02 -2.03 -1.97 -2.20 -2.59 -2.49 -2.99                                                       -2.92 -2.97 -3.73 -2.44 -2.34 -2.75 -3.35 -3.30 -3.64 jacobson 158
159 mti                                                       -2.37 -2.40 -3.02 -2.03 -1.97 -2.20 -2.59 -2.49 -2.99                                                       -2.92 -2.97 -3.73 -2.44 -2.34 -2.75 -3.35 -3.30 -3.64 mti 159
160 mumssp                                                       -2.37 -2.40 -3.02 -2.03 -1.97 -2.20 -2.59 -2.49 -2.99                                                       -2.92 -2.97 -3.73 -2.44 -2.34 -2.75 -3.35 -3.30 -3.64 mumssp 160
161 ricardo                                                       -2.37 -2.40 -3.02 -2.03 -1.97 -2.20 -2.59 -2.49 -2.99                                                       -2.92 -2.97 -3.73 -2.44 -2.34 -2.75 -3.35 -3.30 -3.64 ricardo 161
162 rivilo                                                       -2.37 -2.40 -3.02 -2.03 -1.97 -2.20 -2.59 -2.49 -2.99                                                       -2.92 -2.97 -3.73 -2.44 -2.34 -2.75 -3.35 -3.30 -3.64 rivilo 162
163 sessions                                                       -2.37 -2.40 -3.02 -2.03 -1.97 -2.20 -2.59 -2.49 -2.99                                                       -2.92 -2.97 -3.73 -2.44 -2.34 -2.75 -3.35 -3.30 -3.64 sessions 163
164 test_http_server_01                                                       -2.37 -2.40 -3.02 -2.03 -1.97 -2.20 -2.59 -2.49 -2.99                                                       -2.92 -2.97 -3.73 -2.44 -2.34 -2.75 -3.35 -3.30 -3.64 test_http_server_01 164
165 tripos_08                                                       -2.37 -2.40 -3.02 -2.03 -1.97 -2.20 -2.59 -2.49 -2.99                                                       -2.92 -2.97 -3.73 -2.44 -2.34 -2.75 -3.35 -3.30 -3.64 tripos_08 165
166 xianmingpan                                                       -2.37 -2.40 -3.02 -2.03 -1.97 -2.20 -2.59 -2.49 -2.99                                                       -2.92 -2.97 -3.73 -2.44 -2.34 -2.75 -3.35 -3.30 -3.64 xianmingpan 166