T0469

Targets
387 388 389 390
391 392 393 394
395 396 397 398
399 400 401 402
403 404 405 406
407 408 409 410
411 412 413 414
415 416 417 418
419 420 421 422
423 424 425 426
427 428 429 430
431 432 433 434
435 436 437 438
439 440 441 442
443 444 445 446
447 448 449 450
451 452 453 454
455 456 457 458
459 460 461 462
463 464 465 466
467 468 469 470
471 472 473 474
475 476 477 478
479 480 481 482
483 484 485 486
487 488 489 490
491 492 493 494
495 496 497 498
499 500 501 502
503 504 505 506
507 508 509 510
511 512 513 514

T0469

uncharacterized protein GSU1278 from Methanococcus jannaschii

Target type: Human/Server

Target sequence:

>T0469 GsR195, Geobacter sulfurreducens PCA, 65 residues
MTQKFTKDMTFAQALQTHPGVAGVLRSYNLGCIGCMGAQNESLEQGANAHGLNVEDILRDLNALA

Structure:
Method: NMR
Determined by: NESG
PDB ID: 2k5e

jumping through 469 NMR models
Jumping through 20 NMR models of 2k5e

all 20 469 NMR models
All 20 superimposed NMR models of 2k5e

PyMOL of 2k5e

Domains:  PyMOL of domains

Single domain protein. Very good NMR structure, only C-terminal His-tag residues are poorly ordered, but they were removed from NMR models for evaluation of predictions anyway, as they were not part of the target sequence.

Structure classification:

An unusual helix-turn-helix (HTH) containing protein. The last two α-helices (yellow and orange-red) form the HTH motif, which is readily recognizable by almost perpendicular orientation of the two helices and a long extended "turn" between them that positions the N-terminus of the second helix close to the middle of the first helix. The rest of the structure is unique and shared only with the closest homologs: T0473 and the only full-chain template 2fi0. This N-terminal segment is structured as 3 helices and completes the HTH core in a manner similar to how a single N-terminal helix packs agaist HTH in a classic three-helical bundle fold.

2k5e_1_1_65_ribbon
Ribbon diagram of T0469: 2k5e model 1 residues 1-65

2k5e_1_1_65_ribbon
View of T0469 from the opposite side

We used COMPASS to find homologs of T0469. The first COMPASS hit in the SCOP database is to a typical HTH three-helical bundle. Reasonably small E-value of ~0.06 is almost good enough to validate this match. 

Subject = d1hcra_   a.4.1.2  HIN recombinase (DNA-binding domain)
length=52 filtered_length=51 Neff=12.765 Smith-Waterman score = 46 Evalue = 5.87e-02
QUERY         23     GVLRSYNLGCIGCMGAQNESLEQGANAHGLNVEDILRDLNA  63
CONSENSUS_1   23     EVFLKYGLGCLGCPGAPFETLEDACRAHGIDLDELLEELNE  63
                     +++ + +++++   +A  E++++++R+ G++++ L + L++
CONSENSUS_2   4      PKLTPEQIAEARRLLAAGESVAEIARELGVSRSTLYRYLPA  44
d1hcra_       4      RAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPA  44

All top COMPASS hits are HTH-containing proteins with different SCOP folds. Additionally, their E-values are quite low, so there is little doubt about evolutionary origin of T0469 and its homology to HTH domains. The 51-Gly-Leu-Asn-53 in T0469 is a very typical sequence for an HTH turn, and Ala47, four residues before Gly51, is a conserved small residue to make room for the second HTH helix packing. However only the HTH part of the domain is homologous, as the way it is completed is quite different among homologs:

2k5e_1_1_65
Ribbon diagram of T0469: 2k5e model 1 residues 1-65;
HTH is yellow-orange-red

1hcr_A_142_182
HIN recombinase DNA-binding domain: 1hcr chain A residues 142-182;
HTH is lime-yellow-orange-red

CASP category:

Comparative modeling: medium. Closest template detectable by HHpred, but contains some structural differences.

Closest templates:

The only full-length template was 2fi0, which is another structure of a hypothetical protein determined by a structural genomics center. 

T0469    --MTQKFTKDMTFAQALQTHPGVAGVLRSYNLGCIGCM-----GAQNESLEQGANAHGLNVEDILRDLNALA-------
2fi0_A   VVMDNIIDVSIPVAEVVDKHPEVLEILVELGFKPLANPLMRNTVGRKVSLKQGSKLAGTPMDKIVRTLEANGYEVIGLD

Both molecules are shown below with the most similar HTH region (yellow-red) at the back and more variable N-terminal helices in front. The first two helices (blue-cyan and cyan-green) have very similar orientations in both molecules, however, the differences are pronounced in the green-yellow region, where T0469 has a 6-residue deletion eliminating the fourth helix of 2fi0. Another interesting difference is that 2fi0 contains a C-terminal segment (red) that forms β-strand pairing with the N-terminial segment (blue). Thus a two-stranded β-sheet is present in 2fi0. However, T0469 lacks the C-terminal extension. Nevertheless, the N-terminal region (blue) still holds the extended conformation even without H-bond pairing, at least close to the first helix.

2k5e_1_1_65
Ribbon diagram of T0469: 2k5e model 1 residues 1-65

2fi0_A:6-81
Ribbon diagram of 2fi0 chain A residues 6-81

Target sequence - PDB file inconsistencies:

NMR models contain the C-terminal His-tag residues 66-LEHHHHHH-73, not present in the target sequence. This regions was removed from NMR models due to disorder anyway.

T0469    2k5e.pdb    T0469.pdb    PyMOL    PyMOL of domains    

T0469    1 MTQKFTKDMTFAQALQTHPGVAGVLRSYNLGCIGCMGAQNESLEQGANAHGLNVEDILRDLNALA-------- 65
           |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~~
2k5eA    1 MTQKFTKDMTFAQALQTHPGVAGVLRSYNLGCIGCMGAQNESLEQGANAHGLNVEDILRDLNALALEHHHHHH 73

Residue change log: remove 66-LEHHHHHH-73 as it is not present in target sequence;

Single domain protein: target 1-65 ; pdb 1-65

Sequence classification:

COG2846 in COG database, which is predicted to be "Regulator of cell morphogenesis and NO signaling". Below is PROMALS3D alignment of several most distant homologs detectable by PSI-BLAST. This alignment was not edited manually and may have errors.

Conservation:      9        5        7     6                      5                 7                                                   
T0469         1  --MTQKFTKDMTFAQALQTHPGVAGVLRSYNLGCIGCM-----GAQNESLEQGANAHGLNVEDILRDLNALA------------------------------------------   65
T0473            ----MKITKDMIIADVLQMDRGTAPIFINNGMHCLGCP-----SSMGESIEDACAVHGIDADKLVKELNEYFEKKEV-------------------------------------     
2fi0_chainA   1  VVMDNIIDVSIPVAEVVDKHPEVLEILVELGFKPLANPLMRNTVGRKVSLKQGSKLAGTPMDKIVRTLEANGYEVIGLD-----------------------------------   79
gi_81428069   1  --MAKQIKLSQTVYELVTAYPEIVPILVSIGLDGVTNPALLNTAGRFMTLPKGAQMKQIPLSQIVATLTENDFEVIADD-----------------------------------   77
gi_109645979  1  --MA-LITKDMTVGQVLRSYPQTVQTFLELGMHCLGCPS-----STMESIEGAALTHGKKPDELVEKLNKVI----AAN-----------------------------------   67
gi_95930439   1  ----MLIQPQMTIKQIIDTWPQTLDVFTANGFEQFAQPEMIDRVGRFLKLESALSQKGYDCAAFIALLQERI----DAADQQADI-------TLVE------------------   81
gi_146300169  1  --M--ENLKNKTIGSFVAQDYRTAAVFSKYRIDF-CCK-------GNRTVDEVCEKQNIDADVLLQNIHEVI----QSENNGSIDFNSWPLDLLADYIEKTHHRYVEDKTHTLL   98
gi_163939963  1  --MKHTFTETSIIGEIVTQFPKASDLFKSYRIDF-CCG-------GNRPLIDAINERNLSATEVITELNTLY-NNTKLLNESEIDWKNASYRELIDYVINKHHR----------   93
Consensus_aa:    ..M..bhp.sbhl.phlpp@Pphh.lh.ph.hc..ts...........sl.pthp.pshshs.ll.pLp.............................................     
Consensus_ss:                hhhhhhh   hhhhhhh                    hhhhhhhh   hhhhhhhhhhhh                                               

Comments:

This protein is a close homolog of T0473:

T0469 MTQKFTKDMTFAQALQTHPGVAGVLRSYNLGCIGCMGAQNESLEQGANAHGLNVEDILRDLNALA-----
T0473 --MKITKDMIIADVLQMDRGTAPIFINNGMHCLGCPSSMGESIEDACAVHGIDADKLVKELNEYFEKKEV

Curiously, many sequences of this family contain conserved Cysteine residues in the most varible region of the molecule, and some also contain Histidine in the HTH turn. These residues are highlighted in magenta in the above family alignment and are shown on the structure of T0469. Due to their conservation, it was hypothesized that they might be part of a metal or some other ligand - binding site.

2k5e_1_1_65 C,C,H
Ribbon diagram of T0469: 2k5e model 1 residues 1-65,
Cys32, Cys36 and His50 are shown

Server predictions:

T0469:pdb 1-65:seq 1-65:CM_medium;   alignment

distribution of first scores
First models for T0469: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

# GROUP ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ ↓ GROUP #
T0469 T0469 T0469 T0469
First score First Z-score Best score Best Z-score
1 Chicken_George 80.39 77.05 80.19 0.86 1.25 1.31 80.39 77.05 80.39 0.83 1.19 1.33 Chicken_George 1
2 Zhang−Server 80.00 74.36 77.50 0.83 1.03 1.03 81.92 77.56 77.50 0.97 1.23 1.00 Zhang−Server 2
3 Zhang 79.61 71.67 78.28 0.80 0.81 1.11 80.39 76.28 78.75 0.83 1.12 1.14 Zhang 3
4 SAM−T08−human 79.23 76.67 76.29 0.77 1.22 0.90 79.23 76.67 76.97 0.73 1.15 0.94 SAM−T08−human 4
5 LEE 78.08 67.05 74.73 0.68 0.43 0.74 78.08 70.90 75.95 0.63 0.63 0.82 LEE 5
6 KudlatyPredHuman 77.69 72.31 76.60 0.65 0.86 0.93 78.08 72.95 76.60 0.63 0.81 0.89 KudlatyPredHuman 6
7 ZicoFullSTP 77.69 70.26 74.58 0.65 0.69 0.72 81.15 77.05 77.47 0.90 1.19 0.99 ZicoFullSTP 7
8 Bilab−UT 77.31 70.39 72.65 0.62 0.70 0.52 77.31 70.39 72.65 0.56 0.58 0.44 Bilab−UT 8
9 SAM−T08−server 77.31 68.08 74.70 0.62 0.51 0.74 77.31 71.03 74.70 0.56 0.64 0.68 SAM−T08−server 9
10 SAMUDRALA 76.92 71.28 73.81 0.59 0.78 0.64 76.92 71.80 74.54 0.53 0.71 0.66 SAMUDRALA 10
11 HHpred4 76.92 71.28 73.55 0.59 0.78 0.62 76.92 71.28 73.55 0.53 0.66 0.54 HHpred4 11
12 HHpred2 76.92 71.28 73.55 0.59 0.78 0.62 76.92 71.28 73.55 0.53 0.66 0.54 HHpred2 12
13 HHpred5 76.92 71.28 73.55 0.59 0.78 0.62 76.92 71.28 73.55 0.53 0.66 0.54 HHpred5 13
14 MUProt 76.92 71.03 74.89 0.59 0.76 0.76 76.92 71.03 74.89 0.53 0.64 0.70 MUProt 14
15 Hao_Kihara 76.92 70.51 73.99 0.59 0.71 0.66 76.92 70.51 73.99 0.53 0.59 0.59 Hao_Kihara 15
16 FFASstandard 76.92 70.00 74.53 0.59 0.67 0.72 76.92 70.00 74.53 0.53 0.54 0.66 FFASstandard 16
17 Frankenstein 76.92 70.00 74.47 0.59 0.67 0.71 76.92 70.00 74.47 0.53 0.54 0.65 Frankenstein 17
18 FFASflextemplate 76.92 70.00 74.53 0.59 0.67 0.72 76.92 70.00 74.53 0.53 0.54 0.66 FFASflextemplate 18
19 3DShotMQ 76.92 69.23 73.66 0.59 0.61 0.63 76.92 69.23 73.66 0.53 0.47 0.56 3DShotMQ 19
20 A−TASSER 76.92 69.23 70.61 0.59 0.61 0.31 76.92 69.23 71.41 0.53 0.47 0.30 A−TASSER 20
21 Zico 76.92 68.72 73.79 0.59 0.57 0.64 80.39 71.41 77.47 0.83 0.67 0.99 Zico 21
22 ZicoFullSTPFullData 76.92 68.72 73.79 0.59 0.57 0.64 80.39 71.41 77.47 0.83 0.67 0.99 ZicoFullSTPFullData 22
23 PRI−Yang−KiharA 76.92 67.95 73.63 0.59 0.50 0.63 76.92 67.95 73.63 0.53 0.36 0.55 PRI−Yang−KiharA 23
24 TASSER 76.54 71.41 75.12 0.57 0.79 0.78 76.54 71.41 75.12 0.49 0.67 0.72 TASSER 24
25 ricardo 76.54 71.41 73.28 0.57 0.79 0.59 76.54 71.41 73.28 0.49 0.67 0.51 ricardo 25
26 ACOMPMOD 76.54 70.90 72.23 0.57 0.74 0.48 76.54 70.90 72.23 0.49 0.63 0.39 ACOMPMOD 26
27 Elofsson 76.54 70.13 74.80 0.57 0.68 0.75 76.54 70.13 74.80 0.49 0.56 0.69 Elofsson 27
28 Kolinski 76.54 68.85 73.44 0.57 0.58 0.61 76.54 68.85 73.44 0.49 0.44 0.53 Kolinski 28
29 MUSTER 76.54 68.85 73.41 0.57 0.58 0.60 76.54 68.85 73.41 0.49 0.44 0.53 MUSTER 29
30 CpHModels 76.54 67.82 74.85 0.57 0.49 0.75 76.54 67.82 74.85 0.49 0.34 0.69 CpHModels 30
31 McGuffin 76.54 67.82 74.85 0.57 0.49 0.75 80.77 77.44 77.37 0.87 1.22 0.98 McGuffin 31
32 SHORTLE 76.54 66.80 74.64 0.57 0.41 0.73 77.31 66.80 74.77 0.56 0.25 0.68 SHORTLE 32
33 3D−JIGSAW_AEP 76.15 71.03 73.48 0.54 0.76 0.61 77.31 72.95 73.48 0.56 0.81 0.53 3D−JIGSAW_AEP 33
34 FAMS−multi 76.15 70.51 73.29 0.54 0.71 0.59 76.92 70.51 73.29 0.53 0.59 0.51 FAMS−multi 34
35 RAPTOR 76.15 70.51 74.10 0.54 0.71 0.67 76.15 71.03 74.10 0.46 0.64 0.61 RAPTOR 35
36 3DShot1 76.15 70.26 74.32 0.54 0.69 0.70 76.15 70.26 74.32 0.46 0.57 0.63 3DShot1 36
37 GS−KudlatyPred 76.15 70.26 73.38 0.54 0.69 0.60 76.92 70.26 73.38 0.53 0.57 0.52 GS−KudlatyPred 37
38 MULTICOM−REFINE 76.15 69.74 74.47 0.54 0.65 0.71 76.92 70.00 74.88 0.53 0.54 0.70 MULTICOM−REFINE 38
39 MULTICOM 76.15 69.23 74.32 0.54 0.61 0.70 77.31 71.54 75.46 0.56 0.68 0.76 MULTICOM 39
40 FrankensteinLong 76.15 68.72 72.74 0.54 0.57 0.53 76.15 68.72 72.74 0.46 0.43 0.45 FrankensteinLong 40
41 FOLDpro 76.15 68.46 73.87 0.54 0.54 0.65 76.15 68.46 73.87 0.46 0.40 0.58 FOLDpro 41
42 Jones−UCL 76.15 67.95 73.99 0.54 0.50 0.66 76.15 67.95 73.99 0.46 0.36 0.59 Jones−UCL 42
43 fams−ace2 76.15 67.18 72.49 0.54 0.44 0.51 80.00 76.41 76.59 0.80 1.13 0.89 fams−ace2 43
44 3DShot2 76.15 66.92 71.89 0.54 0.42 0.44 76.15 66.92 71.89 0.46 0.26 0.35 3DShot2 44
45 Pcons_local 76.15 65.64 73.13 0.54 0.31 0.57 76.15 69.23 73.13 0.46 0.47 0.49 Pcons_local 45
46 Pcons_dot_net 76.15 65.64 73.13 0.54 0.31 0.57 76.15 68.97 73.13 0.46 0.45 0.49 Pcons_dot_net 46
47 Pcons_multi 76.15 65.64 73.13 0.54 0.31 0.57 76.15 69.74 73.86 0.46 0.52 0.58 Pcons_multi 47
48 MULTICOM−RANK 75.77 71.41 74.43 0.51 0.79 0.71 76.92 71.80 75.03 0.53 0.71 0.71 MULTICOM−RANK 48
49 BAKER−ROBETTA 75.77 70.13 71.76 0.51 0.68 0.43 75.77 70.13 71.76 0.43 0.56 0.34 BAKER−ROBETTA 49
50 3Dpro 75.77 68.85 74.45 0.51 0.58 0.71 76.15 68.85 74.45 0.46 0.44 0.65 3Dpro 50
51 MULTICOM−CMFR 75.77 68.85 74.07 0.51 0.58 0.67 76.15 68.85 74.07 0.46 0.44 0.60 MULTICOM−CMFR 51
52 PSI 75.77 68.08 69.95 0.51 0.51 0.24 75.77 68.08 69.95 0.43 0.37 0.13 PSI 52
53 FFASsuboptimal 75.77 68.08 69.95 0.51 0.51 0.24 75.77 69.61 73.06 0.43 0.51 0.49 FFASsuboptimal 53
54 MULTICOM−CLUSTER 75.77 67.82 74.19 0.51 0.49 0.68 76.54 70.39 74.19 0.49 0.58 0.62 MULTICOM−CLUSTER 54
55 pipe_int 75.77 66.03 73.06 0.51 0.35 0.57 75.77 66.03 73.06 0.43 0.18 0.49 pipe_int 55
56 NirBenTal 75.77 65.00 72.79 0.51 0.26 0.54 75.77 65.00 72.79 0.43 0.09 0.46 NirBenTal 56
57 Ozkan−Shell 75.77 63.97 72.95 0.51 0.18 0.55 75.77 69.36 74.79 0.43 0.48 0.69 Ozkan−Shell 57
58 Softberry 75.39 71.28 69.96 0.48 0.78 0.24 75.39 71.28 69.96 0.39 0.66 0.13 Softberry 58
59 circle 75.39 68.20 69.93 0.48 0.52 0.24 75.39 71.41 70.85 0.39 0.67 0.23 circle 59
60 IBT_LT 75.39 67.44 72.39 0.48 0.46 0.50 75.39 67.44 72.39 0.39 0.31 0.41 IBT_LT 60
61 nFOLD3 75.39 65.90 71.13 0.48 0.34 0.36 76.54 68.85 71.33 0.49 0.44 0.29 nFOLD3 61
62 PS2−server 75.39 62.05 69.87 0.48 0.02 0.23 75.39 62.05 69.87 0.39 -0.18 0.12 PS2−server 62
63 PS2−manual 75.39 62.05 69.87 0.48 0.02 0.23 75.39 62.05 69.87 0.39 -0.18 0.12 PS2−manual 63
64 DBAKER 75.00 69.87 73.26 0.45 0.66 0.59 75.00 69.87 74.67 0.36 0.53 0.67 DBAKER 64
65 fais−server 75.00 69.61 72.71 0.45 0.64 0.53 75.00 69.61 72.71 0.36 0.51 0.45 fais−server 65
66 FAMSD 75.00 67.82 70.34 0.45 0.49 0.28 75.00 68.85 70.34 0.36 0.44 0.17 FAMSD 66
67 FUGUE_KM 75.00 67.31 70.51 0.45 0.45 0.30 75.00 67.31 70.51 0.36 0.30 0.19 FUGUE_KM 67
68 EB_AMU_Physics 75.00 67.31 71.18 0.45 0.45 0.37 75.39 67.95 71.18 0.39 0.36 0.27 EB_AMU_Physics 68
69 BioSerf 75.00 66.28 71.64 0.45 0.37 0.42 75.00 66.28 71.64 0.36 0.20 0.32 BioSerf 69
70 GS−MetaServer2 75.00 65.51 71.42 0.45 0.30 0.39 76.15 68.20 72.87 0.46 0.38 0.46 GS−MetaServer2 70
71 Sternberg 75.00 65.26 71.97 0.45 0.28 0.45 75.00 65.26 71.97 0.36 0.11 0.36 Sternberg 71
72 Poing 75.00 65.26 72.11 0.45 0.28 0.47 75.00 65.26 72.11 0.36 0.11 0.38 Poing 72
73 Phyre2 75.00 65.26 72.11 0.45 0.28 0.47 75.00 65.26 72.11 0.36 0.11 0.38 Phyre2 73
74 Phyre_de_novo 75.00 65.26 72.11 0.45 0.28 0.47 75.00 65.26 72.11 0.36 0.11 0.38 Phyre_de_novo 74
75 Phragment 75.00 65.26 72.11 0.45 0.28 0.47 75.00 65.26 72.11 0.36 0.11 0.38 Phragment 75
76 mGenTHREADER 75.00 61.92 69.95 0.45 0.01 0.24 75.00 61.92 69.95 0.36 -0.19 0.13 mGenTHREADER 76
77 METATASSER 74.61 69.23 72.32 0.42 0.61 0.49 76.92 69.49 73.22 0.53 0.50 0.51 METATASSER 77
78 pro−sp3−TASSER 74.61 67.69 72.87 0.42 0.48 0.55 76.54 71.67 74.28 0.49 0.70 0.63 pro−sp3−TASSER 78
79 GeneSilicoMetaServer 74.61 67.18 71.12 0.42 0.44 0.36 76.15 68.20 72.87 0.46 0.38 0.46 GeneSilicoMetaServer 79
80 GeneSilico 74.61 65.13 71.08 0.42 0.27 0.36 75.39 69.23 71.32 0.39 0.47 0.29 GeneSilico 80
81 COMA−M 73.85 67.44 71.50 0.36 0.46 0.40 73.85 67.44 71.50 0.26 0.31 0.31 COMA−M 81
82 COMA 73.85 67.44 71.50 0.36 0.46 0.40 73.85 67.44 71.50 0.26 0.31 0.31 COMA 82
83 fleil 73.46 68.59 71.87 0.33 0.56 0.44 75.77 70.90 72.80 0.43 0.63 0.46 fleil 83
84 3D−JIGSAW_V3 73.46 63.72 69.23 0.33 0.16 0.17 78.08 73.97 72.07 0.63 0.91 0.37 3D−JIGSAW_V3 84
85 huber−torda−server 73.46 60.13 65.23 0.33 -0.14 -0.25 73.46 60.13 65.23 0.22 -0.36 -0.41 huber−torda−server 85
86 MidwayFolding 73.08 69.23 69.68 0.30 0.61 0.21 76.15 70.51 73.96 0.46 0.59 0.59 MidwayFolding 86
87 SAM−T02−server 72.69 64.23 64.82 0.27 0.20 -0.29 72.69 64.23 64.82 0.15 0.02 -0.46 SAM−T02−server 87
88 LevittGroup 72.31 61.80 68.64 0.24 0.00 0.10 74.61 65.39 71.89 0.32 0.12 0.35 LevittGroup 88
89 mufold 71.92 63.97 69.72 0.21 0.18 0.22 71.92 63.97 69.72 0.08 -0.01 0.10 mufold 89
90 TJ_Jiang 71.54 63.59 67.60 0.18 0.15 -0.00 71.54 63.59 67.60 0.05 -0.04 -0.14 TJ_Jiang 90
91 AMU−Biology 71.15 62.95 57.25 0.15 0.09 -1.08 71.15 62.95 57.25 0.02 -0.10 -1.33 AMU−Biology 91
92 SMEG−CCP 70.39 63.97 66.31 0.10 0.18 -0.14 70.39 63.97 66.31 -0.05 -0.01 -0.29 SMEG−CCP 92
93 tripos_08 70.39 61.15 57.97 0.10 -0.05 -1.01 70.77 61.80 60.52 -0.02 -0.21 -0.96 tripos_08 93
94 ABIpro 69.61 59.10 67.93 0.04 -0.22 0.03 71.54 62.82 68.37 0.05 -0.11 -0.05 ABIpro 94
95 xianmingpan 68.08 62.69 63.24 -0.08 0.07 -0.46 68.08 62.69 63.24 -0.25 -0.12 -0.64 xianmingpan 95
96 LOOPP_Server 67.69 60.51 56.74 -0.11 -0.11 -1.14 67.69 60.51 56.74 -0.29 -0.32 -1.39 LOOPP_Server 96
97 Handl−Lovell 67.31 51.41 68.52 -0.14 -0.85 0.09 68.08 52.82 69.14 -0.25 -1.03 0.04 Handl−Lovell 97
98 StruPPi 66.92 60.51 67.12 -0.17 -0.11 -0.05 66.92 60.51 67.12 -0.36 -0.32 -0.20 StruPPi 98
99 FEIG 65.00 52.95 62.30 -0.31 -0.72 -0.56 75.39 66.67 70.68 0.39 0.24 0.21 FEIG 99
100 FLOUDAS 58.46 42.82 52.07 -0.81 -1.55 -1.62 59.62 49.10 54.72 -1.00 -1.37 -1.62 FLOUDAS 100
101 PHAISTOS 49.62 43.46 52.04 -1.49 -1.50 -1.63 52.31 43.59 53.47 -1.65 -1.87 -1.77 PHAISTOS 101
102 SAM−T06−server 48.46 42.56 59.60 -1.57 -1.57 -0.84 74.61 65.64 69.58 0.32 0.15 0.09 SAM−T06−server 102
103 Wolynes 45.00 38.08 43.68 -1.84 -1.94 -2.50 45.00 38.08 44.85 -2.30 -2.37 -2.76 Wolynes 103
104 Bates_BMM 43.85 41.92 54.30 -1.93 -1.63 -1.39 73.08 68.59 68.10 0.19 0.41 -0.08 Bates_BMM 104
105 forecast 43.85 33.59 44.20 -1.93 -2.31 -2.45 45.00 37.31 45.85 -2.30 -2.44 -2.64 forecast 105
106 FALCON 43.46 40.13 50.27 -1.96 -1.77 -1.81 58.46 50.77 59.89 -1.11 -1.21 -1.03 FALCON 106
107 POEM 43.46 39.87 57.23 -1.96 -1.79 -1.09 48.85 40.77 57.68 -1.96 -2.13 -1.28 POEM 107
108 ShakAbInitio 42.69 39.10 46.60 -2.01 -1.86 -2.19 42.69 39.10 49.43 -2.50 -2.28 -2.23 ShakAbInitio 108
109 Sasaki−Cetin−Sasai 42.31 38.20 52.70 -2.04 -1.93 -1.56 49.23 47.56 57.95 -1.92 -1.51 -1.25 Sasaki−Cetin−Sasai 109
110 POEMQA 42.31 38.08 52.90 -2.04 -1.94 -1.54 42.69 41.15 54.76 -2.50 -2.09 -1.62 POEMQA 110
111 keasar−server 41.54 39.49 45.21 -2.10 -1.82 -2.34 42.69 40.13 45.61 -2.50 -2.18 -2.67 keasar−server 111
112 RBO−Proteus 41.54 35.64 54.18 -2.10 -2.14 -1.40 43.46 41.15 54.18 -2.43 -2.09 -1.69 RBO−Proteus 112
113 SAINT1 41.15 39.36 49.85 -2.13 -1.84 -1.86 41.15 39.36 49.85 -2.64 -2.25 -2.18 SAINT1 113
114 MUFOLD−MD 40.77 37.56 49.13 -2.16 -1.98 -1.93 40.77 37.56 50.16 -2.67 -2.42 -2.15 MUFOLD−MD 114
115 schenk−torda−server 39.62 33.46 40.27 -2.25 -2.32 -2.86 39.62 33.46 40.27 -2.77 -2.79 -3.29 schenk−torda−server 115
116 keasar 39.23 34.49 53.87 -2.28 -2.23 -1.44 43.46 41.28 55.97 -2.43 -2.08 -1.48 keasar 116
117 MeilerLabRene 37.69 31.03 47.29 -2.40 -2.52 -2.12 41.92 37.82 50.98 -2.57 -2.40 -2.05 MeilerLabRene 117
118 FALCON_CONSENSUS 37.69 30.00 38.52 -2.40 -2.60 -3.04 54.62 44.49 51.42 -1.45 -1.79 -2.00 FALCON_CONSENSUS 118
119 Jiang_Zhu 36.15 34.10 40.63 -2.51 -2.27 -2.82 38.08 34.10 40.63 -2.91 -2.74 -3.24 Jiang_Zhu 119
120 rehtnap 35.38 34.62 28.99 -2.57 -2.22 -4.03 35.38 34.62 28.99 -3.15 -2.69 -4.58 rehtnap 120
121 JIVE08 35.38 33.08 44.10 -2.57 -2.35 -2.46 62.31 52.56 54.66 -0.77 -1.05 -1.63 JIVE08 121
122 MUFOLD−Server 35.38 30.51 46.78 -2.57 -2.56 -2.18 35.77 30.90 46.81 -3.11 -3.03 -2.53 MUFOLD−Server 122
123 BHAGEERATH 33.46 29.74 40.77 -2.72 -2.62 -2.80 33.46 29.74 40.93 -3.32 -3.13 -3.21 BHAGEERATH 123
124 RPFM 33.46 28.08 37.45 -2.72 -2.76 -3.15 33.46 28.08 42.92 -3.32 -3.28 -2.98 RPFM 124
125 dill_ucsf 32.69 28.33 28.50 -2.78 -2.74 -4.08 32.69 28.33 39.49 -3.39 -3.26 -3.38 dill_ucsf 125
126 igor 32.69 28.08 39.24 -2.78 -2.76 -2.96 32.69 28.08 39.24 -3.39 -3.28 -3.40 igor 126
127 mariner1 32.31 23.97 29.00 -2.81 -3.09 -4.03 43.46 37.82 44.62 -2.43 -2.40 -2.79 mariner1 127
128 DistillSN 31.92 29.10 41.01 -2.83 -2.67 -2.78 35.77 31.92 41.01 -3.11 -2.93 -3.20 DistillSN 128
129 RANDOM 30.80 23.67 30.80 -2.92 -3.12 -3.84 30.80 23.67 30.80 -3.55 -3.69 -4.38 RANDOM 129
130 Distill 30.77 28.46 46.05 -2.92 -2.73 -2.25 30.77 28.46 46.05 -3.56 -3.25 -2.62 Distill 130
131 Scheraga 30.39 24.10 38.85 -2.95 -3.08 -3.00 42.69 32.18 38.85 -2.50 -2.91 -3.45 Scheraga 131
132 DelCLab 28.85 25.00 35.15 -3.07 -3.01 -3.39 28.85 25.00 35.15 -3.73 -3.57 -3.87 DelCLab 132
133 mahmood−torda−server 28.46 24.61 29.33 -3.10 -3.04 -4.00 28.85 26.03 36.29 -3.73 -3.47 -3.74 mahmood−torda−server 133
134 Pushchino 27.31 24.10 26.95 -3.19 -3.08 -4.24 27.31 24.10 26.95 -3.86 -3.65 -4.82 Pushchino 134
135 OLGAFS 23.08 18.97 20.29 -3.51 -3.50 -4.94 23.08 22.05 20.29 -4.24 -3.84 -5.58 OLGAFS 135
136 TWPPLAB 22.31 18.46 12.33 -3.57 -3.54 -5.77 22.31 18.46 12.33 -4.30 -4.16 -6.50 TWPPLAB 136
137 Abagyan                   -2.92 -3.12 -3.84                   -3.55 -3.69 -4.38 Abagyan 137
138 CBSU                   -2.92 -3.12 -3.84                   -3.55 -3.69 -4.38 CBSU 138
139 FEIG_REFINE                   -2.92 -3.12 -3.84                   -3.55 -3.69 -4.38 FEIG_REFINE 139
140 Fiser−M4T                   -2.92 -3.12 -3.84                   -3.55 -3.69 -4.38 Fiser−M4T 140
141 HCA                   -2.92 -3.12 -3.84                   -3.55 -3.69 -4.38 HCA 141
142 LEE−SERVER                   -2.92 -3.12 -3.84                   -3.55 -3.69 -4.38 LEE−SERVER 142
143 Linnolt−UH−CMB                   -2.92 -3.12 -3.84                   -3.55 -3.69 -4.38 Linnolt−UH−CMB 143
144 NIM2                   -2.92 -3.12 -3.84                   -3.55 -3.69 -4.38 NIM2 144
145 Nano_team                   -2.92 -3.12 -3.84                   -3.55 -3.69 -4.38 Nano_team 145
146 POISE                   -2.92 -3.12 -3.84                   -3.55 -3.69 -4.38 POISE 146
147 PZ−UAM                   -2.92 -3.12 -3.84                   -3.55 -3.69 -4.38 PZ−UAM 147
148 ProtAnG                   -2.92 -3.12 -3.84                   -3.55 -3.69 -4.38 ProtAnG 148
149 ProteinShop                   -2.92 -3.12 -3.84                   -3.55 -3.69 -4.38 ProteinShop 149
150 TsaiLab                   -2.92 -3.12 -3.84                   -3.55 -3.69 -4.38 TsaiLab 150
151 UCDavisGenome                   -2.92 -3.12 -3.84                   -3.55 -3.69 -4.38 UCDavisGenome 151
152 Wolfson−FOBIA                   -2.92 -3.12 -3.84                   -3.55 -3.69 -4.38 Wolfson−FOBIA 152
153 YASARA                   -2.92 -3.12 -3.84                   -3.55 -3.69 -4.38 YASARA 153
154 YASARARefine                   -2.92 -3.12 -3.84                   -3.55 -3.69 -4.38 YASARARefine 154
155 Zhou−SPARKS                   -2.92 -3.12 -3.84                   -3.55 -3.69 -4.38 Zhou−SPARKS 155
156 dill_ucsf_extended                   -2.92 -3.12 -3.84                   -3.55 -3.69 -4.38 dill_ucsf_extended 156
157 fais@hgc                   -2.92 -3.12 -3.84                   -3.55 -3.69 -4.38 fais@hgc 157
158 jacobson                   -2.92 -3.12 -3.84                   -3.55 -3.69 -4.38 jacobson 158
159 mti                   -2.92 -3.12 -3.84                   -3.55 -3.69 -4.38 mti 159
160 mumssp                   -2.92 -3.12 -3.84                   -3.55 -3.69 -4.38 mumssp 160
161 panther_server                   -2.92 -3.12 -3.84                   -3.55 -3.69 -4.38 panther_server 161
162 psiphifoldings                   -2.92 -3.12 -3.84                   -3.55 -3.69 -4.38 psiphifoldings 162
163 rivilo                   -2.92 -3.12 -3.84                   -3.55 -3.69 -4.38 rivilo 163
164 sessions                   -2.92 -3.12 -3.84                   -3.55 -3.69 -4.38 sessions 164
165 taylor                   -2.92 -3.12 -3.84                   -3.55 -3.69 -4.38 taylor 165
166 test_http_server_01                   -2.92 -3.12 -3.84                   -3.55 -3.69 -4.38 test_http_server_01 166