T0391

Targets
387 388 389 390
391 392 393 394
395 396 397 398
399 400 401 402
403 404 405 406
407 408 409 410
411 412 413 414
415 416 417 418
419 420 421 422
423 424 425 426
427 428 429 430
431 432 433 434
435 436 437 438
439 440 441 442
443 444 445 446
447 448 449 450
451 452 453 454
455 456 457 458
459 460 461 462
463 464 465 466
467 468 469 470
471 472 473 474
475 476 477 478
479 480 481 482
483 484 485 486
487 488 489 490
491 492 493 494
495 496 497 498
499 500 501 502
503 504 505 506
507 508 509 510
511 512 513 514

T0391

rieske ferredoxin Mus musculus

Target type: Human/Server

Target sequence:

>T0391 rieske ferredoxin, mouse, 157 residues
SDPEISEQDEEKKKYTSVCVGREEDIRKSERMTAVVHDREVVIFYHKGEYHAMDIRCYHSGGPLHLGEIEDFNGQSCIVCPWHKYKITLATGEGLYQSINPKDPSAKPKWCSKGVKQRIHTVKVDNGNIYVTLSKEPFKCDSDYYATGEFKVIQSSS

Structure:
Method: X-ray, res=2.07Å, R/Rfree=0.20/0.23
Determined by: CESG
PDB ID: 3d89

PyMOL of 3d89

Domains:  PyMOL of domains

Two domain protein. However, domains are tightly associated and the bondary between them is not clearly defined. It might be reasonable to evaluate predictions on the whole chain only. Evolutionarily, rubredoxin-like domain (red, residues 55-117), incidentally homologous to T0464, is inserted into a larger 6-stranded β-barrel domain (blue, residues 14-54 and 118-154).

One complication with the domain definition is that the C-terminal segment of the larger (blue) domain interacts closely with the rubredoxin-like domain (red), but cannot be its part evolutionarily. This C-terminal extension composed of an α-helix and a long loop reaching to the [2Fe-2S] cluster, residues 138-154, is shown in blue on the image above, and in green on the image below.

To compute the weighted sum, GDT-TS for each domain was multiplied by the domain length, and this sum was divided by the sum of domain lengths. Each point represents first server model. Green, gray and black points are top 10, bottom 25% and the rest of prediction models. Blue line is the best-fit slope line (intersection 0) to the top 10 server models. Red line is the diagonal. Slope and root mean square y-x distance for the top 10 models (average difference between the weighted sum of domain GDT-TS scores and the whole chain GDT-TS score) are shown above the plot.

Structure classification:

ISP domain fold

CASP category:

Whole chain: Comparative modeling:hard.

1st domain: Comparative modeling:medium. 2nd domain: Comparative modeling:medium.

Closest templates:

2b1x chain A.

Target sequence - PDB file inconsistencies:

The following residues are missing from PDB: 1-SDPEISEQDEEKK-13, 100-KDPSA-104, 155-SSS-157, but PDB numbering agrees with the target sequence numbering.

T0391    3d89.pdb    T0391.pdb    PyMOL    PyMOL of domains   

T0391    1 SDPEISEQDEEKKKYTSVCVGREEDIRKSERMTAVVHDREVVIFYHKGEYHAMDIRCYHSGGPLHLGEIEDFNGQSCIVCPWHKYKITLATGEGLYQSINPKDPSAKPKWCSKGVKQRIHTVKVDNGNIYVTLSKEPFKCDSDYYATGEFKVIQSSS 157
           ~~~~~~~~~~~~~||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~||||||||||||||||||||||||||||||||||||||||||||||||~~~
3d89A   14 -------------KYTSVCVGREEDIRKSERMTAVVHDREVVIFYHKGEYHAMDIRCYHSGGPLHLGEIEDFNGQSCIVCPWHKYKITLATGEGLYQSINP-----KPKWCSKGVKQRIHTVKVDNGNIYVTLSKEPFKCDSDYYATGEFKVIQ--- 154

We suggest to evaluate this target as a single domain spanning whole chain. However, evolutionarily this is a 2-domain protein, although domains are tightly associated and the boundary between them is not clearly defined:

1st domain: target 14-54, 118-154 ; pdb 14-54, 118-154

2nd domain: target 55-101, 107-117 ; pdb 55-101, 107-117

Sequence classification:

Rieske [2Fe-2S] ferredoxin domain (PF00355) in Pfam.

Server predictions:

T0391:pdb 14-154:seq 14-154:CM_hard;   alignment

391_1:pdb 14-54,118-154:seq 14-54,118-154:CM_medium;   alignment

391_2:pdb 55-117:seq 55-117:CM_medium;   alignment

click on a score in the table below to display the model in PyMOL

# GROUP ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ ↓ GROUP #
T0391 391_1 391_2 T0391 391_1 391_2 T0391 391_1 391_2 T0391 391_1 391_2
First score First Z-score Best score Best Z-score
1 IBT_LT 68.93 65.26 71.25 67.95 55.77 78.19 81.03 78.45 84.84 1.13 1.45 1.39 0.37 -0.10 0.22 2.37 2.73 2.52 68.93 65.26 71.25 67.95 55.77 78.19 81.03 78.45 84.84 1.15 1.34 1.40 0.16 -0.65 -0.08 2.60 2.79 2.52 IBT_LT 1
2 Sternberg 67.83 63.17 69.34 70.51 61.33 79.12 73.71 70.26 80.07 1.03 1.25 1.18 0.63 0.47 0.33 1.41 1.75 1.71 67.83 63.17 69.34 70.51 61.33 79.12 73.71 70.26 80.07 1.00 1.08 1.13 0.54 0.15 0.06 1.33 1.58 1.53 Sternberg 2
3 Phyre_de_novo 67.83 63.17 69.34 70.51 61.33 84.77 73.71 70.26 80.07 1.03 1.25 1.18 0.63 0.47 0.95 1.41 1.75 1.71 67.83 63.17 69.34 70.51 64.42 84.77 73.71 70.26 80.07 1.00 1.08 1.13 0.54 0.59 0.93 1.33 1.58 1.53 Phyre_de_novo 3
4 Zico 67.46 61.95 69.01 70.83 62.50 78.80 72.41 68.39 79.82 0.99 1.13 1.14 0.66 0.59 0.29 1.24 1.53 1.66 67.46 61.95 69.01 71.80 65.81 79.89 72.41 68.39 79.82 0.94 0.92 1.08 0.73 0.79 0.18 1.11 1.31 1.48 Zico 4
5 ZicoFullSTP 67.46 61.95 69.01 70.83 62.50 78.80 72.41 68.39 79.82 0.99 1.13 1.14 0.66 0.59 0.29 1.24 1.53 1.66 67.46 61.95 69.01 71.80 65.81 79.89 72.41 68.39 79.82 0.94 0.92 1.08 0.73 0.79 0.18 1.11 1.31 1.48 ZicoFullSTP 5
6 ZicoFullSTPFullData 67.46 61.95 69.01 70.83 62.50 78.80 72.41 68.39 79.82 0.99 1.13 1.14 0.66 0.59 0.29 1.24 1.53 1.66 67.46 61.95 69.01 71.80 65.81 79.89 72.41 68.39 79.82 0.94 0.92 1.08 0.73 0.79 0.18 1.11 1.31 1.48 ZicoFullSTPFullData 6
7 LEE 66.91 53.55 64.58 70.83 65.92 76.82 68.97 61.78 74.26 0.94 0.30 0.66 0.66 0.94 0.07 0.79 0.73 0.72 68.02 61.77 64.77 72.44 65.92 77.14 69.40 61.78 74.62 1.02 0.90 0.48 0.83 0.81 -0.25 0.59 0.33 0.41 LEE 7
8 A−TASSER 66.73 61.58 63.51 69.23 60.04 77.81 67.24 58.91 71.69 0.92 1.09 0.54 0.50 0.34 0.18 0.57 0.39 0.28 66.73 61.58 63.51 69.23 64.85 77.81 67.24 58.91 72.05 0.84 0.88 0.30 0.35 0.65 -0.14 0.21 -0.10 -0.12 A−TASSER 8
9 HHpred4 66.54 61.27 65.54 65.70 61.43 81.05 74.14 71.26 78.68 0.90 1.06 0.76 0.15 0.48 0.54 1.47 1.87 1.47 66.54 61.27 65.54 65.70 61.43 81.05 74.14 71.26 78.68 0.81 0.84 0.59 -0.18 0.16 0.35 1.41 1.73 1.25 HHpred4 9
10 pro−sp3−TASSER 66.54 60.54 65.28 72.11 65.28 84.77 68.10 56.61 72.92 0.90 0.99 0.73 0.79 0.88 0.95 0.68 0.11 0.49 66.73 60.54 65.28 72.11 65.70 84.77 68.10 59.91 73.96 0.84 0.75 0.55 0.78 0.77 0.93 0.36 0.05 0.28 pro−sp3−TASSER 10
11 SHORTLE 65.99 61.58 68.10 68.59 62.82 78.63 72.84 72.27 79.52 0.84 1.09 1.04 0.44 0.62 0.27 1.30 1.99 1.61 65.99 61.58 68.10 68.59 62.82 78.63 72.84 72.27 79.52 0.73 0.88 0.95 0.25 0.36 -0.02 1.18 1.88 1.42 SHORTLE 11
12 Frankenstein 65.99 61.09 65.58 69.87 64.74 83.09 70.26 63.08 76.14 0.84 1.04 0.77 0.57 0.82 0.76 0.96 0.89 1.04 65.99 61.09 65.58 69.87 64.74 85.34 70.26 63.08 76.14 0.73 0.82 0.59 0.44 0.64 1.01 0.74 0.52 0.73 Frankenstein 12
13 McGuffin 65.99 61.09 65.58 69.87 64.74 76.82 70.26 63.08 76.14 0.84 1.04 0.77 0.57 0.82 0.07 0.96 0.89 1.04 65.99 61.09 65.58 71.80 64.85 79.71 71.12 63.08 76.14 0.73 0.82 0.59 0.73 0.65 0.15 0.88 0.52 0.73 McGuffin 13
14 GeneSilico 65.81 62.50 66.45 67.95 63.89 78.53 71.12 61.64 76.45 0.83 1.18 0.86 0.37 0.73 0.26 1.07 0.72 1.09 65.81 63.17 66.73 70.51 64.10 80.41 71.12 63.22 76.45 0.71 1.08 0.76 0.54 0.55 0.26 0.88 0.54 0.79 GeneSilico 14
15 MULTICOM 65.62 60.85 65.28 72.11 65.70 78.84 67.67 59.34 73.54 0.81 1.02 0.73 0.79 0.92 0.30 0.62 0.44 0.59 67.10 61.58 69.26 72.11 66.35 79.12 73.28 69.54 80.40 0.89 0.88 1.12 0.78 0.87 0.06 1.26 1.48 1.60 MULTICOM 15
16 3DShot1 65.62 59.99 64.08 70.51 64.96 77.42 67.67 54.17 72.68 0.81 0.93 0.60 0.63 0.84 0.14 0.62 -0.18 0.45 65.62 59.99 64.08 70.51 64.96 77.42 67.67 54.17 72.68 0.68 0.68 0.38 0.54 0.67 -0.20 0.29 -0.80 0.01 3DShot1 16
17 Pcons_local 65.62 57.29 64.25 68.91 62.29 82.96 68.53 58.19 74.13 0.81 0.67 0.62 0.47 0.57 0.75 0.74 0.30 0.69 65.62 57.60 64.25 68.91 62.29 83.56 68.53 60.63 74.41 0.68 0.37 0.40 0.30 0.29 0.74 0.44 0.16 0.37 Pcons_local 17
18 3DShotMQ 65.44 60.91 65.48 71.15 61.97 78.35 65.95 60.49 74.51 0.79 1.02 0.75 0.69 0.54 0.24 0.40 0.58 0.76 65.44 60.91 65.48 71.15 61.97 78.35 65.95 60.49 74.51 0.66 0.79 0.58 0.64 0.24 -0.06 -0.01 0.14 0.39 3DShotMQ 18
19 Zhang−Server 65.44 59.56 65.50 71.80 62.82 84.80 67.67 58.76 73.69 0.79 0.89 0.76 0.76 0.62 0.95 0.62 0.37 0.62 65.81 62.01 69.15 71.80 64.53 85.33 72.41 68.53 79.21 0.71 0.93 1.10 0.73 0.61 1.01 1.11 1.33 1.36 Zhang−Server 19
20 SAM−T02−server 65.26 59.25 63.68 69.23 61.75 83.05 68.53 63.65 72.49 0.77 0.86 0.56 0.50 0.51 0.76 0.74 0.96 0.41 65.26 59.25 63.68 69.55 63.78 83.05 68.53 63.65 72.55 0.63 0.58 0.32 0.40 0.50 0.66 0.44 0.60 -0.01 SAM−T02−server 20
21 Zhang 65.07 61.03 69.97 70.51 64.10 80.10 73.71 70.83 80.61 0.75 1.04 1.25 0.63 0.75 0.43 1.41 1.82 1.80 65.26 61.95 70.29 72.44 66.45 80.95 73.71 70.83 80.61 0.63 0.92 1.26 0.83 0.88 0.34 1.33 1.67 1.65 Zhang 21
22 Zhou−SPARKS 65.07 61.03 64.53 69.55 57.16 78.00 68.53 59.34 73.37 0.75 1.04 0.65 0.53 0.04 0.20 0.74 0.44 0.56 65.07 61.03 64.53 69.55 57.16 78.00 68.53 59.34 73.37 0.60 0.81 0.44 0.40 -0.45 -0.11 0.44 -0.03 0.16 Zhou−SPARKS 22
23 LevittGroup 65.07 58.82 64.55 66.67 57.69 74.34 69.83 64.66 76.62 0.75 0.82 0.65 0.25 0.10 -0.20 0.91 1.08 1.12 65.26 60.23 64.75 66.67 57.69 75.64 69.83 67.53 76.62 0.63 0.71 0.47 -0.04 -0.37 -0.48 0.66 1.18 0.82 LevittGroup 23
24 SAM−T06−server 65.07 58.82 65.34 66.99 61.00 85.03 68.10 56.61 72.83 0.75 0.82 0.74 0.28 0.44 0.98 0.68 0.11 0.47 65.07 58.82 65.34 67.95 61.00 85.03 68.10 58.48 72.83 0.60 0.53 0.56 0.16 0.10 0.97 0.36 -0.16 0.04 SAM−T06−server 24
25 MULTICOM−CLUSTER 65.07 57.84 64.36 69.55 62.71 84.06 68.10 55.46 72.70 0.75 0.72 0.63 0.53 0.61 0.87 0.68 -0.03 0.45 65.07 57.84 65.47 70.83 66.35 85.38 68.10 61.92 73.43 0.60 0.40 0.58 0.59 0.87 1.02 0.36 0.35 0.17 MULTICOM−CLUSTER 25
26 BioSerf 64.89 60.35 64.23 68.27 61.22 83.54 68.10 58.05 72.76 0.74 0.97 0.62 0.41 0.46 0.81 0.68 0.28 0.46 64.89 60.35 64.23 68.27 61.22 83.54 68.10 58.05 72.76 0.58 0.72 0.40 0.20 0.13 0.74 0.36 -0.22 0.03 BioSerf 26
27 circle 64.89 60.23 63.31 68.91 61.65 83.22 68.10 55.46 72.28 0.74 0.96 0.52 0.47 0.50 0.78 0.68 -0.03 0.38 65.07 61.27 63.86 69.23 61.97 83.83 68.10 58.05 72.36 0.60 0.84 0.35 0.35 0.24 0.78 0.36 -0.22 -0.05 circle 27
28 HHpred5 64.52 59.74 65.63 64.10 59.40 80.40 74.14 70.69 78.91 0.70 0.91 0.77 -0.01 0.27 0.47 1.47 1.80 1.51 64.52 59.74 65.63 64.10 59.40 80.40 74.14 70.69 78.91 0.53 0.64 0.60 -0.42 -0.13 0.25 1.41 1.65 1.30 HHpred5 28
29 MidwayFolding 64.52 59.13 64.15 69.23 59.83 75.28 68.97 66.09 75.39 0.70 0.85 0.61 0.50 0.32 -0.10 0.79 1.25 0.91 64.52 59.13 64.15 69.23 59.83 75.28 68.97 66.09 75.39 0.53 0.57 0.39 0.35 -0.07 -0.53 0.51 0.97 0.57 MidwayFolding 29
30 RAPTOR 64.52 59.13 63.66 69.55 60.58 81.31 68.97 66.09 75.39 0.70 0.85 0.55 0.53 0.39 0.57 0.79 1.25 0.91 64.52 59.13 63.66 69.55 60.58 82.43 71.12 66.09 75.56 0.53 0.57 0.32 0.40 0.04 0.57 0.88 0.97 0.61 RAPTOR 30
31 3D−JIGSAW_V3 64.52 56.80 64.83 70.19 64.85 83.28 71.12 62.21 75.34 0.70 0.62 0.68 0.60 0.83 0.79 1.07 0.78 0.90 64.89 58.70 64.93 70.19 64.96 83.39 71.12 62.36 76.95 0.58 0.51 0.50 0.49 0.67 0.71 0.88 0.41 0.89 3D−JIGSAW_V3 31
32 mufold 64.34 60.29 67.70 71.15 63.25 79.17 69.83 63.79 77.87 0.68 0.96 1.00 0.69 0.67 0.33 0.91 0.97 1.33 64.34 60.29 67.70 71.15 63.25 79.17 69.83 63.79 78.38 0.50 0.71 0.89 0.64 0.42 0.07 0.66 0.63 1.19 mufold 32
33 fams−ace2 64.15 57.90 64.40 71.15 65.17 78.07 68.10 58.33 73.03 0.66 0.73 0.64 0.69 0.86 0.21 0.68 0.32 0.51 64.15 57.90 65.02 71.15 65.17 79.16 68.10 62.50 73.19 0.47 0.41 0.51 0.64 0.70 0.06 0.36 0.43 0.12 fams−ace2 33
34 SAM−T08−server 63.97 59.19 62.81 68.91 62.71 82.75 66.81 64.22 71.65 0.65 0.86 0.46 0.47 0.61 0.73 0.51 1.03 0.27 63.97 59.19 62.81 68.91 63.78 83.36 66.81 64.22 71.65 0.45 0.58 0.20 0.30 0.50 0.71 0.14 0.69 -0.20 SAM−T08−server 34
35 METATASSER 63.97 57.72 62.94 70.51 66.24 82.64 65.95 53.30 72.26 0.65 0.71 0.47 0.63 0.97 0.72 0.40 -0.29 0.37 65.81 62.50 64.46 70.51 66.24 84.31 67.24 58.76 72.26 0.71 0.99 0.43 0.54 0.85 0.86 0.21 -0.12 -0.07 METATASSER 35
36 TASSER 63.97 56.86 64.19 71.80 66.24 77.27 66.81 55.03 73.44 0.65 0.63 0.61 0.76 0.97 0.12 0.51 -0.08 0.58 65.81 57.97 64.67 71.80 66.24 78.03 67.67 59.91 73.96 0.71 0.42 0.46 0.73 0.85 -0.11 0.29 0.05 0.28 TASSER 36
37 mGenTHREADER 63.60 55.64 61.53 67.31 60.04 81.78 65.95 61.64 70.27 0.61 0.51 0.32 0.31 0.34 0.62 0.40 0.72 0.04 63.60 55.64 61.53 67.31 60.04 81.78 65.95 61.64 70.27 0.40 0.13 0.01 0.06 -0.04 0.47 -0.01 0.31 -0.48 mGenTHREADER 37
38 Pcons_multi 63.05 55.33 62.46 69.23 58.76 83.24 65.09 55.03 70.62 0.56 0.48 0.42 0.50 0.21 0.78 0.29 -0.08 0.10 65.44 56.74 64.61 70.83 66.24 84.89 66.81 55.32 72.70 0.66 0.27 0.45 0.59 0.85 0.94 0.14 -0.63 0.02 Pcons_multi 38
39 3D−JIGSAW_AEP 62.87 54.04 61.68 69.55 59.72 82.18 64.22 51.29 71.44 0.54 0.35 0.34 0.53 0.31 0.66 0.18 -0.53 0.24 63.05 54.35 62.25 69.55 62.93 82.39 65.09 55.03 72.00 0.32 -0.04 0.12 0.40 0.38 0.56 -0.16 -0.67 -0.13 3D−JIGSAW_AEP 39
40 Bilab−UT 62.50 54.17 63.08 68.27 62.07 77.02 62.93 52.30 70.74 0.50 0.37 0.49 0.41 0.55 0.10 0.01 -0.41 0.12 62.50 56.86 63.08 68.27 62.07 77.02 68.97 62.93 72.94 0.24 0.28 0.24 0.20 0.25 -0.26 0.51 0.50 0.07 Bilab−UT 40
41 FALCON 62.32 53.37 63.38 67.31 60.90 83.47 63.79 53.16 71.24 0.48 0.29 0.52 0.31 0.43 0.81 0.12 -0.30 0.20 65.99 61.03 64.53 70.19 60.90 83.95 68.97 59.34 73.61 0.73 0.81 0.44 0.49 0.09 0.80 0.51 -0.03 0.21 FALCON 41
42 Poing 62.13 60.42 61.91 67.95 57.48 83.61 63.79 60.34 68.96 0.47 0.98 0.36 0.37 0.08 0.82 0.12 0.56 -0.19 64.52 60.42 64.98 68.91 64.42 85.07 67.24 63.36 72.21 0.53 0.73 0.51 0.30 0.59 0.97 0.21 0.56 -0.08 Poing 42
43 Phyre2 62.13 60.42 61.60 67.95 57.48 83.19 63.79 60.34 68.96 0.47 0.98 0.33 0.37 0.08 0.78 0.12 0.56 -0.19 64.52 60.42 63.69 68.91 64.64 84.94 67.24 63.36 72.21 0.53 0.73 0.32 0.30 0.62 0.95 0.21 0.56 -0.08 Phyre2 43
44 Phragment 62.13 60.42 61.88 67.95 57.48 83.57 63.79 60.34 68.96 0.47 0.98 0.36 0.37 0.08 0.82 0.12 0.56 -0.19 65.44 60.42 63.53 69.55 64.64 84.89 67.24 63.36 72.21 0.66 0.73 0.30 0.40 0.62 0.94 0.21 0.56 -0.08 Phragment 44
45 CpHModels 62.13 56.01 61.72 66.35 57.59 79.53 66.38 57.76 73.90 0.47 0.55 0.34 0.21 0.09 0.37 0.46 0.25 0.65 62.13 56.01 61.72 66.35 57.59 79.53 66.38 57.76 73.90 0.19 0.17 0.04 -0.08 -0.39 0.12 0.06 -0.27 0.26 CpHModels 45
46 ACOMPMOD 62.13 49.27 58.48 66.35 58.23 77.30 64.22 59.63 71.54 0.47 -0.11 -0.02 0.21 0.15 0.13 0.18 0.47 0.25 63.79 56.07 64.45 69.23 61.75 84.02 64.66 59.63 72.01 0.42 0.18 0.43 0.35 0.21 0.81 -0.23 0.01 -0.12 ACOMPMOD 46
47 JIVE08 61.95 54.10 60.60 66.67 61.54 72.17 67.67 57.90 72.49 0.45 0.36 0.22 0.25 0.49 -0.44 0.62 0.27 0.41 65.07 61.40 63.33 70.83 66.35 76.99 67.67 58.62 72.49 0.60 0.85 0.27 0.59 0.87 -0.27 0.29 -0.14 -0.03 JIVE08 47
48 TJ_Jiang 61.58 53.55 61.39 63.78 53.53 73.07 66.81 55.60 71.86 0.41 0.30 0.30 -0.04 -0.33 -0.34 0.51 -0.01 0.31 62.32 56.68 61.61 66.67 58.12 76.26 67.24 59.77 71.86 0.22 0.26 0.03 -0.04 -0.31 -0.38 0.21 0.03 -0.16 TJ_Jiang 48
49 SAMUDRALA 61.40 54.17 63.61 71.80 65.17 78.69 67.24 56.61 72.17 0.39 0.37 0.55 0.76 0.86 0.28 0.57 0.11 0.36 62.87 58.21 65.63 73.08 69.87 82.65 68.97 59.20 73.40 0.29 0.45 0.60 0.93 1.37 0.60 0.51 -0.05 0.16 SAMUDRALA 49
50 MULTICOM−REFINE 61.21 54.23 65.18 70.19 61.65 85.22 66.38 61.49 72.96 0.38 0.37 0.72 0.60 0.50 1.00 0.46 0.70 0.49 64.71 56.98 65.23 71.80 61.65 85.22 67.67 61.49 73.09 0.55 0.30 0.54 0.73 0.19 1.00 0.29 0.28 0.10 MULTICOM−REFINE 50
51 MUProt 61.21 53.98 65.11 70.83 62.50 85.16 66.38 52.30 72.85 0.38 0.35 0.71 0.66 0.59 0.99 0.46 -0.41 0.48 61.58 53.98 65.38 71.15 63.03 85.45 66.38 60.34 73.05 0.11 -0.08 0.56 0.64 0.39 1.03 0.06 0.11 0.09 MUProt 51
52 Chicken_George 61.21 49.33 67.62 66.99 60.15 78.22 72.84 70.26 78.52 0.38 -0.11 0.99 0.28 0.35 0.23 1.30 1.75 1.44 61.95 57.29 67.62 73.40 69.98 78.22 73.71 70.55 80.24 0.16 0.34 0.88 0.97 1.39 -0.08 1.33 1.63 1.57 Chicken_George 52
53 LEE−SERVER 61.03 51.96 62.45 67.63 61.22 82.47 64.22 58.19 71.00 0.36 0.15 0.42 0.34 0.46 0.70 0.18 0.30 0.16 61.40 54.04 63.50 67.95 61.22 82.98 65.09 58.76 72.34 0.09 -0.07 0.30 0.16 0.13 0.65 -0.16 -0.12 -0.06 LEE−SERVER 53
54 Elofsson 61.03 51.35 65.03 70.83 56.94 79.22 67.24 56.32 73.08 0.36 0.09 0.70 0.66 0.02 0.34 0.57 0.08 0.51 61.77 56.37 65.63 71.15 63.89 79.96 67.24 57.62 73.40 0.14 0.22 0.60 0.64 0.52 0.19 0.21 -0.29 0.16 Elofsson 54
55 fleil 60.66 56.74 60.78 67.31 53.85 73.81 63.36 56.47 70.37 0.32 0.62 0.24 0.31 -0.30 -0.26 0.06 0.09 0.05 61.58 56.92 60.87 67.95 59.40 74.37 63.79 58.19 70.37 0.11 0.29 -0.08 0.16 -0.13 -0.67 -0.38 -0.20 -0.46 fleil 55
56 nFOLD3 60.66 49.82 56.78 63.14 56.52 75.68 64.22 56.75 70.60 0.32 -0.06 -0.20 -0.11 -0.02 -0.05 0.18 0.13 0.09 64.15 59.87 59.50 68.59 63.67 78.82 67.24 61.21 71.83 0.47 0.66 -0.27 0.25 0.48 0.01 0.21 0.24 -0.16 nFOLD3 56
57 Jones−UCL 60.48 55.70 59.62 66.67 57.48 73.85 64.22 53.59 69.71 0.30 0.51 0.11 0.25 0.08 -0.25 0.18 -0.25 -0.06 60.48 55.70 59.62 66.67 57.48 73.85 64.22 53.59 69.71 -0.04 0.13 -0.26 -0.04 -0.41 -0.75 -0.31 -0.88 -0.60 Jones−UCL 57
58 MUSTER 60.48 52.51 60.88 65.39 56.41 81.15 63.79 55.17 69.24 0.30 0.20 0.25 0.12 -0.03 0.55 0.12 -0.06 -0.14 63.23 57.60 63.47 67.31 62.39 82.07 69.40 60.78 75.95 0.34 0.37 0.29 0.06 0.30 0.51 0.59 0.18 0.69 MUSTER 58
59 Fiser−M4T 60.48 52.39 60.56 62.18 56.62 78.58 65.52 62.64 73.48 0.30 0.19 0.21 -0.20 -0.01 0.27 0.34 0.84 0.58 60.48 52.39 60.56 62.18 56.62 78.58 65.52 62.64 73.48 -0.04 -0.28 -0.12 -0.71 -0.53 -0.02 -0.08 0.46 0.18 Fiser−M4T 59
60 SAM−T08−human 60.11 56.07 63.82 70.51 61.54 79.58 63.36 58.48 71.18 0.27 0.55 0.57 0.63 0.49 0.38 0.06 0.34 0.19 60.48 56.07 64.89 70.83 62.71 79.93 66.38 60.34 72.81 -0.04 0.18 0.49 0.59 0.35 0.18 0.06 0.11 0.04 SAM−T08−human 60
61 FAMS−multi 60.11 52.63 62.32 70.83 61.43 76.32 66.38 64.08 71.65 0.27 0.21 0.41 0.66 0.48 0.02 0.46 1.01 0.27 61.58 53.98 62.32 71.15 65.60 76.32 67.24 64.08 71.88 0.11 -0.08 0.13 0.64 0.76 -0.37 0.21 0.67 -0.15 FAMS−multi 61
62 FFASflextemplate 59.93 53.06 59.48 63.46 60.90 76.11 68.97 58.05 75.41 0.25 0.26 0.09 -0.07 0.43 -0.01 0.79 0.28 0.91 59.93 53.06 59.60 64.42 61.00 76.65 68.97 64.08 75.41 -0.12 -0.20 -0.26 -0.37 0.10 -0.32 0.51 0.67 0.58 FFASflextemplate 62
63 FFASsuboptimal 59.93 47.30 61.51 63.78 60.58 77.02 69.40 63.08 77.86 0.25 -0.31 0.32 -0.04 0.39 0.10 0.85 0.89 1.33 59.93 49.51 61.95 65.39 60.68 77.67 70.69 65.95 77.86 -0.12 -0.65 0.07 -0.23 0.05 -0.16 0.81 0.94 1.08 FFASsuboptimal 63
64 FUGUE_KM 59.74 50.55 53.98 66.35 58.44 77.79 59.05 48.42 62.68 0.23 0.01 -0.51 0.21 0.17 0.18 -0.50 -0.87 -1.26 63.23 56.74 59.52 67.63 65.06 82.19 67.67 63.08 70.87 0.34 0.27 -0.27 0.11 0.68 0.53 0.29 0.52 -0.36 FUGUE_KM 64
65 Pcons_dot_net 59.19 54.17 55.73 65.06 54.17 76.31 61.21 50.58 68.18 0.18 0.37 -0.32 0.09 -0.26 0.02 -0.22 -0.61 -0.32 61.21 54.17 62.09 69.23 59.62 82.56 62.50 59.05 70.39 0.06 -0.06 0.09 0.35 -0.10 0.59 -0.61 -0.08 -0.46 Pcons_dot_net 65
66 Hao_Kihara 59.19 51.59 59.50 69.23 64.10 75.74 59.91 49.28 67.76 0.18 0.11 0.10 0.50 0.75 -0.05 -0.39 -0.77 -0.39 64.15 58.15 62.64 69.23 64.10 77.74 66.38 63.51 73.01 0.47 0.44 0.17 0.35 0.55 -0.15 0.06 0.58 0.08 Hao_Kihara 66
67 MULTICOM−RANK 59.19 50.49 63.55 70.19 62.07 84.34 65.52 57.76 71.53 0.18 0.01 0.54 0.60 0.55 0.90 0.34 0.25 0.25 61.95 56.68 65.47 70.83 62.18 85.38 66.38 60.06 73.09 0.16 0.26 0.58 0.59 0.27 1.02 0.06 0.07 0.10 MULTICOM−RANK 67
68 forecast 59.01 50.31 58.69 65.06 55.23 81.73 58.62 50.58 66.08 0.16 -0.01 0.01 0.09 -0.16 0.61 -0.55 -0.61 -0.68 59.01 50.31 59.15 70.19 61.22 83.27 61.21 52.87 70.73 -0.25 -0.55 -0.32 0.49 0.13 0.70 -0.83 -0.99 -0.39 forecast 68
69 FEIG 58.82 49.45 57.99 61.86 58.65 78.32 66.81 64.22 69.68 0.14 -0.10 -0.07 -0.23 0.20 0.24 0.51 1.03 -0.06 62.32 56.07 63.29 66.03 62.50 81.18 69.40 65.23 76.84 0.22 0.18 0.27 -0.13 0.32 0.37 0.59 0.84 0.87 FEIG 69
70 PS2−manual 58.46 53.92 55.96 68.27 60.79 76.73 53.88 49.57 61.34 0.10 0.34 -0.29 0.41 0.42 0.06 -1.17 -0.73 -1.48 63.42 56.98 63.60 68.27 61.11 76.94 64.66 56.32 74.31 0.37 0.30 0.31 0.20 0.12 -0.28 -0.23 -0.48 0.35 PS2−manual 70
71 DBAKER 58.46 51.59 59.00 61.54 54.49 73.13 62.93 51.72 68.88 0.10 0.11 0.04 -0.27 -0.23 -0.33 0.01 -0.48 -0.20 63.05 58.27 62.07 68.27 65.92 77.21 66.38 63.22 73.28 0.32 0.46 0.09 0.20 0.81 -0.24 0.06 0.54 0.14 DBAKER 71
72 Softberry 58.09 49.39 54.49 59.30 47.12 63.00 64.22 60.78 69.72 0.07 -0.10 -0.46 -0.49 -0.99 -1.45 0.18 0.61 -0.06 58.09 49.39 54.49 59.30 47.12 63.00 64.22 60.78 69.72 -0.38 -0.66 -0.99 -1.14 -1.89 -2.42 -0.31 0.18 -0.60 Softberry 72
73 FFASstandard 58.09 45.71 61.10 63.78 59.30 76.46 68.53 65.95 77.63 0.07 -0.46 0.27 -0.04 0.26 0.03 0.74 1.23 1.29 61.77 54.78 61.10 66.03 61.00 77.52 68.97 65.95 77.63 0.14 0.02 -0.05 -0.13 0.10 -0.19 0.51 0.94 1.03 FFASstandard 73
74 panther_server 57.54 49.82 53.04 65.39 62.39 76.23 59.05 53.30 64.16 0.01 -0.06 -0.62 0.12 0.58 0.01 -0.50 -0.29 -1.00 60.48 54.90 57.39 65.39 62.39 77.65 69.40 62.50 74.29 -0.04 0.03 -0.58 -0.23 0.30 -0.17 0.59 0.43 0.35 panther_server 74
75 Bates_BMM 56.80 50.80 59.65 68.59 63.46 78.58 60.34 51.15 65.71 -0.06 0.04 0.11 0.44 0.69 0.27 -0.33 -0.54 -0.74 56.80 50.80 59.71 68.59 63.46 78.64 61.21 53.74 65.80 -0.57 -0.48 -0.24 0.25 0.45 -0.02 -0.83 -0.86 -1.40 Bates_BMM 75
76 FrankensteinLong 56.80 46.75 57.01 68.91 61.43 78.46 54.74 48.99 61.78 -0.06 -0.36 -0.18 0.47 0.48 0.25 -1.06 -0.80 -1.41 65.26 56.68 65.13 70.19 61.43 80.79 69.83 59.48 74.75 0.63 0.26 0.53 0.49 0.16 0.31 0.66 -0.01 0.44 FrankensteinLong 76
77 3Dpro 56.43 46.02 57.79 67.95 56.84 81.84 50.86 44.83 63.93 -0.09 -0.43 -0.09 0.37 0.01 0.63 -1.57 -1.30 -1.04 64.15 59.68 65.38 67.95 60.79 82.65 73.71 67.24 80.00 0.47 0.64 0.56 0.16 0.07 0.60 1.33 1.14 1.52 3Dpro 77
78 MULTICOM−CMFR 56.25 51.47 59.39 67.31 62.82 84.03 60.34 52.30 65.52 -0.11 0.10 0.08 0.31 0.62 0.87 -0.33 -0.41 -0.77 58.09 51.72 59.86 68.59 62.82 84.54 61.64 54.60 65.87 -0.38 -0.37 -0.22 0.25 0.36 0.89 -0.76 -0.73 -1.39 MULTICOM−CMFR 78
79 FAMSD 56.07 49.08 54.52 62.50 53.31 75.78 59.91 49.28 68.09 -0.13 -0.13 -0.45 -0.17 -0.35 -0.04 -0.39 -0.77 -0.34 61.95 56.43 60.13 67.31 61.75 83.69 68.10 63.79 73.57 0.16 0.23 -0.18 0.06 0.21 0.76 0.36 0.63 0.20 FAMSD 79
80 PZ−UAM 56.07 47.61 61.21 68.91 61.86 78.62 61.64 58.48 69.32 -0.13 -0.28 0.28 0.47 0.53 0.27 -0.16 0.34 -0.13 56.07 47.61 61.21 68.91 61.86 78.62 61.64 58.48 69.32 -0.67 -0.89 -0.03 0.30 0.22 -0.02 -0.76 -0.16 -0.68 PZ−UAM 80
81 PRI−Yang−KiharA 55.88 47.43 61.63 68.59 61.11 78.83 61.21 56.03 69.59 -0.15 -0.29 0.33 0.44 0.45 0.29 -0.22 0.04 -0.08 55.88 47.43 61.63 68.59 61.11 78.83 61.21 56.03 69.59 -0.70 -0.91 0.03 0.25 0.12 0.01 -0.83 -0.52 -0.62 PRI−Yang−KiharA 81
82 3DShot2 55.70 45.90 57.76 64.42 59.94 81.52 61.21 53.45 65.91 -0.17 -0.44 -0.10 0.02 0.33 0.59 -0.22 -0.27 -0.71 55.70 45.90 57.76 64.42 59.94 81.52 61.21 53.45 65.91 -0.72 -1.10 -0.52 -0.37 -0.05 0.43 -0.83 -0.90 -1.38 3DShot2 82
83 GS−KudlatyPred 55.52 48.04 60.21 68.91 61.65 84.23 59.05 52.73 68.79 -0.18 -0.23 0.17 0.47 0.50 0.89 -0.50 -0.35 -0.22 55.52 48.04 60.21 68.91 61.65 84.23 59.05 52.73 68.79 -0.75 -0.83 -0.17 0.30 0.19 0.84 -1.20 -1.01 -0.79 GS−KudlatyPred 83
84 COMA−M 55.33 47.37 61.34 68.59 57.27 83.87 61.64 52.73 69.98 -0.20 -0.30 0.30 0.44 0.05 0.85 -0.16 -0.35 -0.01 63.79 58.40 64.01 70.19 62.50 84.02 65.95 57.90 72.17 0.42 0.48 0.37 0.49 0.32 0.81 -0.01 -0.25 -0.09 COMA−M 84
85 SMEG−CCP 55.33 47.24 56.74 63.46 59.62 68.07 65.09 54.88 69.93 -0.20 -0.31 -0.21 -0.07 0.30 -0.89 0.29 -0.10 -0.02 55.33 47.24 56.74 63.46 59.62 68.07 65.09 54.88 69.93 -0.77 -0.93 -0.67 -0.52 -0.10 -1.64 -0.16 -0.69 -0.55 SMEG−CCP 85
86 ABIpro 55.33 46.14 58.49 67.63 55.98 74.21 49.14 42.24 65.02 -0.20 -0.42 -0.02 0.34 -0.08 -0.22 -1.79 -1.61 -0.86 55.52 47.79 58.49 67.95 58.55 75.03 49.57 43.25 65.59 -0.75 -0.86 -0.42 0.16 -0.25 -0.57 -2.84 -2.41 -1.45 ABIpro 86
87 fais−server 55.15 49.88 60.34 68.91 59.94 83.73 59.05 55.32 69.71 -0.22 -0.05 0.19 0.47 0.33 0.84 -0.50 -0.04 -0.06 60.48 54.96 61.75 68.91 63.78 85.07 63.36 55.60 69.75 -0.04 0.04 0.05 0.30 0.50 0.97 -0.46 -0.59 -0.59 fais−server 87
88 COMA 55.15 46.45 60.23 69.23 62.39 83.68 59.05 52.16 69.12 -0.22 -0.39 0.18 0.50 0.58 0.83 -0.50 -0.42 -0.16 55.33 47.37 64.01 69.23 62.39 84.02 61.64 52.73 72.17 -0.77 -0.92 0.37 0.35 0.30 0.81 -0.76 -1.01 -0.09 COMA 88
89 GeneSilicoMetaServer 54.96 45.28 60.01 69.87 59.83 84.72 56.90 51.72 66.63 -0.24 -0.50 0.15 0.57 0.32 0.94 -0.78 -0.48 -0.58 63.79 61.46 60.78 70.19 62.82 84.72 62.50 57.62 68.05 0.42 0.86 -0.09 0.49 0.36 0.92 -0.61 -0.29 -0.94 GeneSilicoMetaServer 89
90 AMU−Biology 54.78 48.16 59.68 66.67 61.11 77.31 60.78 55.89 68.50 -0.26 -0.22 0.12 0.25 0.45 0.13 -0.27 0.03 -0.27 59.38 50.55 64.55 70.83 61.11 79.50 66.38 60.06 74.12 -0.20 -0.52 0.45 0.59 0.12 0.12 0.06 0.07 0.31 AMU−Biology 90
91 HHpred2 54.78 45.83 60.59 68.27 55.02 83.90 59.91 52.73 69.66 -0.26 -0.45 0.22 0.41 -0.18 0.85 -0.39 -0.35 -0.07 54.78 45.83 60.59 68.27 55.02 83.90 59.91 52.73 69.66 -0.85 -1.11 -0.12 0.20 -0.76 0.79 -1.05 -1.01 -0.61 HHpred2 91
92 huber−torda−server 54.60 47.98 46.08 57.05 50.43 68.65 59.91 50.72 61.64 -0.27 -0.24 -1.38 -0.71 -0.65 -0.83 -0.39 -0.60 -1.43 55.33 50.67 46.08 62.82 58.55 76.48 59.91 50.72 61.64 -0.77 -0.50 -2.19 -0.61 -0.25 -0.35 -1.05 -1.31 -2.26 huber−torda−server 92
93 Jiang_Zhu 54.60 44.67 61.71 66.35 62.07 76.50 66.38 58.33 72.84 -0.27 -0.56 0.34 0.21 0.55 0.04 0.46 0.32 0.47 63.97 59.56 64.17 67.31 62.07 76.50 76.29 70.98 78.87 0.45 0.62 0.39 0.06 0.25 -0.34 1.78 1.69 1.29 Jiang_Zhu 93
94 GS−MetaServer2 54.41 45.71 57.91 67.95 61.75 83.53 59.48 56.61 66.07 -0.29 -0.46 -0.08 0.37 0.51 0.81 -0.44 0.11 -0.68 55.33 49.20 60.87 68.91 63.78 84.72 62.93 56.61 69.21 -0.77 -0.69 -0.08 0.30 0.50 0.92 -0.53 -0.44 -0.70 GS−MetaServer2 94
95 PS2−server 54.23 44.12 51.78 49.36 44.44 66.85 65.95 56.18 73.04 -0.31 -0.62 -0.75 -1.48 -1.26 -1.03 0.40 0.06 0.51 63.05 55.82 61.31 67.63 61.00 83.82 68.97 60.63 77.70 0.32 0.15 -0.02 0.11 0.10 0.78 0.51 0.16 1.05 PS2−server 95
96 mti 52.57 42.40 58.67 65.39 54.06 74.45 58.19 47.41 66.40 -0.47 -0.79 0.00 0.12 -0.28 -0.19 -0.61 -0.99 -0.62 63.42 57.35 64.17 68.91 62.93 75.94 66.81 56.18 74.72 0.37 0.34 0.39 0.30 0.38 -0.43 0.14 -0.50 0.43 mti 96
97 keasar−server 52.57 41.05 57.37 65.39 62.18 81.68 61.21 51.15 66.90 -0.47 -0.92 -0.14 0.12 0.56 0.61 -0.22 -0.54 -0.54 64.71 59.68 63.59 68.91 62.18 83.07 67.67 56.75 72.77 0.55 0.64 0.31 0.30 0.27 0.67 0.29 -0.42 0.03 keasar−server 97
98 sessions 52.02 49.45 44.74 59.62 54.91 57.77 52.59 44.54 61.07 -0.53 -0.10 -1.53 -0.46 -0.19 -2.03 -1.34 -1.34 -1.53 52.02 49.45 44.74 59.62 54.91 57.77 52.59 44.54 61.07 -1.24 -0.65 -2.38 -1.09 -0.77 -3.22 -2.32 -2.22 -2.38 sessions 98
99 pipe_int 52.02 41.60 55.90 66.67 60.26 82.02 58.62 48.85 64.77 -0.53 -0.86 -0.30 0.25 0.36 0.65 -0.55 -0.82 -0.90 62.87 58.21 63.94 68.27 61.22 82.19 67.67 61.35 75.23 0.29 0.45 0.36 0.20 0.13 0.53 0.29 0.26 0.54 pipe_int 99
100 EB_AMU_Physics 51.84 41.18 58.20 64.10 50.85 74.72 58.62 54.88 68.26 -0.55 -0.90 -0.05 -0.01 -0.60 -0.16 -0.55 -0.10 -0.31 51.84 41.18 58.20 64.10 50.85 74.72 58.62 54.88 68.26 -1.27 -1.70 -0.46 -0.42 -1.36 -0.62 -1.28 -0.69 -0.90 EB_AMU_Physics 100
101 fais@hgc 51.47 43.02 62.27 63.78 53.10 72.04 65.95 54.17 78.11 -0.58 -0.72 0.40 -0.04 -0.37 -0.45 0.40 -0.18 1.37 65.62 62.01 69.15 72.11 65.70 79.89 72.41 65.23 79.21 0.68 0.93 1.10 0.78 0.77 0.18 1.11 0.84 1.36 fais@hgc 101
102 PSI 51.10 42.77 49.51 64.74 61.75 75.71 57.76 49.71 61.96 -0.62 -0.75 -1.00 0.05 0.51 -0.05 -0.67 -0.72 -1.38 66.18 57.11 63.34 68.91 61.86 82.19 68.10 57.76 73.44 0.76 0.31 0.27 0.30 0.22 0.53 0.36 -0.27 0.17 PSI 102
103 Kolinski 50.37 40.44 52.37 61.54 46.47 69.22 57.76 54.31 64.58 -0.69 -0.98 -0.69 -0.27 -1.05 -0.77 -0.67 -0.16 -0.93 50.37 40.44 52.37 61.54 46.47 69.22 57.76 54.31 64.58 -1.48 -1.79 -1.29 -0.80 -1.99 -1.46 -1.43 -0.78 -1.65 Kolinski 103
104 rehtnap 50.18 40.75 51.20 63.46 55.98 76.50 56.47 48.42 63.39 -0.71 -0.95 -0.82 -0.07 -0.08 0.04 -0.83 -0.87 -1.14 51.47 42.16 51.20 63.46 59.40 76.50 57.76 49.42 63.77 -1.32 -1.57 -1.46 -0.52 -0.13 -0.34 -1.43 -1.50 -1.82 rehtnap 104
105 BAKER−ROBETTA 49.08 39.77 56.33 60.90 57.05 79.83 59.05 51.58 67.54 -0.82 -1.04 -0.25 -0.33 0.03 0.41 -0.50 -0.49 -0.43 51.84 44.73 62.27 63.78 60.04 83.71 65.95 54.17 78.11 -1.27 -1.25 0.12 -0.47 -0.04 0.76 -0.01 -0.80 1.13 BAKER−ROBETTA 105
106 CBSU 46.32 38.36 39.98 56.41 47.44 56.90 50.43 44.40 52.87 -1.09 -1.18 -2.05 -0.78 -0.95 -2.12 -1.62 -1.35 -2.93 47.79 39.58 41.43 56.41 50.75 57.28 50.43 45.26 54.97 -1.84 -1.90 -2.85 -1.57 -1.37 -3.30 -2.69 -2.12 -3.63 CBSU 106
107 NIM2 44.85 40.20 30.97 36.54 33.76 27.94 62.93 59.77 67.38 -1.23 -1.00 -3.05 -2.76 -2.36 -5.32 0.01 0.49 -0.46 44.85 40.20 30.97 36.54 33.76 27.94 62.93 59.77 67.38 -2.26 -1.82 -4.34 -4.55 -3.81 -7.81 -0.53 0.03 -1.08 NIM2 107
108 FLOUDAS 39.15 30.33 35.82 45.51 35.68 44.97 49.14 33.91 58.11 -1.79 -1.97 -2.51 -1.86 -2.16 -3.44 -1.79 -2.61 -2.03 39.15 30.33 37.83 45.51 35.68 46.55 49.14 38.08 59.16 -3.06 -3.07 -3.36 -3.21 -3.53 -4.95 -2.92 -3.18 -2.77 FLOUDAS 108
109 xianmingpan 34.19 26.59 32.17 47.12 39.00 47.57 37.50 30.60 50.24 -2.28 -2.33 -2.91 -1.70 -1.82 -3.15 -3.31 -3.01 -3.38 34.19 26.59 32.17 47.12 39.00 47.57 37.50 30.60 50.24 -3.76 -3.54 -4.17 -2.97 -3.06 -4.79 -4.93 -4.29 -4.60 xianmingpan 109
110 MUFOLD−MD 32.54 26.41 43.53 46.80 38.89 69.89 40.52 38.51 60.37 -2.44 -2.35 -1.66 -1.74 -1.83 -0.69 -2.91 -2.06 -1.65 32.54 26.41 43.53 46.80 38.89 69.89 47.41 40.23 60.37 -4.00 -3.56 -2.55 -3.01 -3.07 -1.36 -3.22 -2.86 -2.52 MUFOLD−MD 110
111 FOLDpro 31.80 27.14 33.73 24.36 22.01 51.54 56.03 50.29 65.59 -2.51 -2.28 -2.74 -3.97 -3.56 -2.72 -0.89 -0.65 -0.76 48.53 43.26 45.65 50.96 46.47 66.18 59.48 52.59 66.99 -1.74 -1.44 -2.25 -2.39 -1.99 -1.93 -1.13 -1.03 -1.16 FOLDpro 111
112 Distill 31.25 25.61 33.20 30.45 25.75 57.45 46.55 39.66 57.81 -2.57 -2.43 -2.80 -3.37 -3.18 -2.06 -2.13 -1.92 -2.09 32.72 27.02 35.86 33.33 29.49 59.53 46.55 39.66 57.96 -3.97 -3.49 -3.64 -5.03 -4.42 -2.95 -3.37 -2.94 -3.02 Distill 112
113 POEMQA 27.57 24.27 38.05 31.09 22.76 49.07 48.28 35.92 60.57 -2.93 -2.56 -2.27 -3.30 -3.49 -2.99 -1.90 -2.37 -1.62 65.07 59.93 64.97 70.83 66.35 78.55 68.10 55.89 73.52 0.60 0.67 0.51 0.59 0.87 -0.03 0.36 -0.54 0.19 POEMQA 113
114 keasar 26.65 24.82 36.56 31.09 23.61 48.34 48.28 41.09 59.05 -3.02 -2.50 -2.43 -3.30 -3.40 -3.07 -1.90 -1.75 -1.87 63.05 58.64 63.54 68.91 65.49 75.99 69.83 67.53 74.54 0.32 0.51 0.30 0.30 0.74 -0.42 0.66 1.18 0.40 keasar 114
115 Wolynes 23.53 20.10 29.13 36.86 28.31 46.63 28.45 26.44 48.07 -3.33 -2.97 -3.25 -2.73 -2.92 -3.26 -4.49 -3.51 -3.74 25.00 20.22 29.39 37.18 33.12 48.26 28.88 26.44 48.07 -5.07 -4.34 -4.57 -4.46 -3.90 -4.68 -6.42 -4.90 -5.05 Wolynes 115
116 RBO−Proteus 22.06 19.98 38.61 29.81 26.82 63.54 45.26 39.80 61.32 -3.47 -2.98 -2.21 -3.43 -3.07 -1.39 -2.29 -1.91 -1.49 27.02 22.86 39.62 31.41 26.82 63.54 50.43 46.98 63.52 -4.78 -4.01 -3.11 -5.32 -4.81 -2.34 -2.69 -1.86 -1.87 RBO−Proteus 116
117 FALCON_CONSENSUS 20.96 19.00 32.29 33.01 30.88 58.78 29.31 26.72 54.56 -3.58 -3.07 -2.90 -3.11 -2.65 -1.92 -4.37 -3.48 -2.64 29.96 25.31 32.29 37.50 33.44 61.38 42.24 37.36 55.21 -4.36 -3.70 -4.15 -4.41 -3.86 -2.67 -4.11 -3.29 -3.58 FALCON_CONSENSUS 117
118 DistillSN 20.96 16.30 27.35 25.00 17.73 42.76 31.90 26.15 45.45 -3.58 -3.34 -3.45 -3.91 -4.00 -3.69 -4.04 -3.55 -4.19 20.96 16.30 27.35 25.00 21.69 42.76 31.90 27.01 47.96 -5.64 -4.84 -4.86 -6.28 -5.54 -5.53 -5.90 -4.82 -5.07 DistillSN 118
119 POEM 20.59 18.38 32.88 27.24 23.93 43.25 40.09 34.34 57.11 -3.62 -3.13 -2.84 -3.69 -3.37 -3.63 -2.97 -2.56 -2.21 34.74 30.58 64.97 39.74 36.11 78.55 59.48 52.01 73.52 -3.69 -3.04 0.51 -4.07 -3.47 -0.03 -1.13 -1.12 0.19 POEM 119
120 mariner1 20.22 15.44 18.41 26.28 22.44 46.80 27.16 22.27 46.35 -3.65 -3.42 -4.43 -3.78 -3.52 -3.24 -4.65 -4.01 -4.04 59.38 47.73 56.68 64.10 57.05 76.02 63.79 61.21 71.58 -0.20 -0.87 -0.68 -0.42 -0.47 -0.42 -0.38 0.24 -0.21 mariner1 120
121 Sasaki−Cetin−Sasai 18.75 16.05 22.49 25.00 21.58 21.94 39.22 38.94 58.67 -3.80 -3.36 -3.98 -3.91 -3.61 -5.98 -3.08 -2.01 -1.94 19.67 17.71 23.38 28.53 25.75 22.80 43.53 38.94 59.04 -5.82 -4.66 -5.42 -5.75 -4.96 -8.60 -3.89 -3.05 -2.79 Sasaki−Cetin−Sasai 121
122 StruPPi 16.54 12.13 21.54 25.96 17.84 34.24 25.43 18.82 45.80 -4.01 -3.74 -4.09 -3.81 -3.99 -4.63 -4.88 -4.43 -4.13 40.81 31.37 41.03 39.42 30.56 46.13 53.88 43.82 65.39 -2.83 -2.94 -2.91 -4.12 -4.27 -5.01 -2.10 -2.33 -1.49 StruPPi 122
123 OLGAFS 14.89 13.66 10.65 23.72 21.37 45.60 18.97 16.52 35.36 -4.18 -3.59 -5.28 -4.04 -3.63 -3.37 -5.72 -4.70 -5.91 50.18 40.62 38.82 58.33 50.85 68.32 48.71 40.37 48.99 -1.50 -1.77 -3.22 -1.29 -1.36 -1.60 -2.99 -2.84 -4.86 OLGAFS 123
124 TWPPLAB 14.71 13.36 17.08 19.87 14.32 31.01 21.55 20.26 40.95 -4.19 -3.62 -4.58 -4.42 -4.35 -4.98 -5.38 -4.25 -4.96 14.71 13.36 17.08 19.87 14.32 31.01 21.55 20.26 40.95 -6.52 -5.21 -6.32 -7.05 -6.60 -7.33 -7.69 -5.82 -6.52 TWPPLAB 124
125 RANDOM 14.62 12.36 14.62 25.66 22.01 25.66 19.96 17.25 19.96 -4.20 -3.72 -4.85 -3.84 -3.56 -5.57 -5.59 -4.61 -8.53 14.62 12.36 14.62 25.66 22.01 25.66 19.96 17.25 19.96 -6.53 -5.34 -6.67 -6.18 -5.50 -8.16 -7.96 -6.26 -10.84 RANDOM 125
126 ProtAnG 14.52 12.99 18.83 21.80 19.02 32.25 23.71 21.41 42.75 -4.21 -3.66 -4.38 -4.23 -3.87 -4.84 -5.10 -4.12 -4.65 14.52 12.99 18.83 21.80 19.02 32.25 23.71 21.41 42.75 -6.55 -5.26 -6.07 -6.76 -5.93 -7.14 -7.32 -5.64 -6.15 ProtAnG 126
127 DelCLab 14.15 12.07 15.71 19.55 16.88 27.65 19.40 17.24 41.90 -4.25 -3.75 -4.73 -4.45 -4.09 -5.35 -5.66 -4.62 -4.80 15.81 14.09 17.97 23.08 19.55 32.64 21.12 17.24 41.99 -6.37 -5.12 -6.19 -6.57 -5.85 -7.08 -7.76 -6.26 -6.30 DelCLab 127
128 MUFOLD−Server 13.79 11.64 21.98 20.83 19.55 49.08 28.45 28.16 49.65 -4.28 -3.79 -4.04 -4.33 -3.82 -2.99 -4.49 -3.30 -3.48 15.99 13.97 21.98 25.96 22.11 49.08 28.45 28.16 49.65 -6.34 -5.13 -5.62 -6.14 -5.48 -4.56 -6.50 -4.65 -4.73 MUFOLD−Server 128
129 psiphifoldings 12.32 11.70 17.29 19.23 18.16 32.20 25.00 22.41 41.14 -4.43 -3.79 -4.55 -4.49 -3.96 -4.85 -4.93 -3.99 -4.92 12.32 11.70 17.29 19.23 18.16 32.20 25.00 22.41 41.14 -6.86 -5.42 -6.29 -7.15 -6.05 -7.15 -7.09 -5.50 -6.48 psiphifoldings 129
130 mahmood−torda−server 12.32 10.48 15.81 16.03 13.03 48.10 22.41 17.24 41.27 -4.43 -3.91 -4.72 -4.81 -4.49 -3.10 -5.27 -4.62 -4.90 13.23 10.85 16.68 18.59 14.74 49.15 24.14 21.55 41.47 -6.73 -5.53 -6.38 -7.24 -6.54 -4.55 -7.24 -5.62 -6.41 mahmood−torda−server 130
131 schenk−torda−server 12.13 11.21 13.57 18.27 17.20 47.64 21.98 18.10 38.19 -4.45 -3.83 -4.96 -4.58 -4.06 -3.15 -5.33 -4.51 -5.43 14.34 13.48 15.45 21.15 20.51 48.81 21.98 20.55 41.43 -6.57 -5.19 -6.55 -6.86 -5.71 -4.60 -7.62 -5.77 -6.42 schenk−torda−server 131
132 Abagyan                                                       -4.20 -3.72 -4.85 -3.84 -3.56 -5.57 -5.59 -4.61 -8.53                                                       -6.53 -5.34 -6.67 -6.18 -5.50 -8.16 -7.96 -6.26 -10.84 Abagyan 132
133 BHAGEERATH                                                       -4.20 -3.72 -4.85 -3.84 -3.56 -5.57 -5.59 -4.61 -8.53                                                       -6.53 -5.34 -6.67 -6.18 -5.50 -8.16 -7.96 -6.26 -10.84 BHAGEERATH 133
134 FEIG_REFINE                                                       -4.20 -3.72 -4.85 -3.84 -3.56 -5.57 -5.59 -4.61 -8.53                                                       -6.53 -5.34 -6.67 -6.18 -5.50 -8.16 -7.96 -6.26 -10.84 FEIG_REFINE 134
135 HCA                                                       -4.20 -3.72 -4.85 -3.84 -3.56 -5.57 -5.59 -4.61 -8.53                                                       -6.53 -5.34 -6.67 -6.18 -5.50 -8.16 -7.96 -6.26 -10.84 HCA 135
136 Handl−Lovell                                                       -4.20 -3.72 -4.85 -3.84 -3.56 -5.57 -5.59 -4.61 -8.53                                                       -6.53 -5.34 -6.67 -6.18 -5.50 -8.16 -7.96 -6.26 -10.84 Handl−Lovell 136
137 KudlatyPredHuman                                                       -4.20 -3.72 -4.85 -3.84 -3.56 -5.57 -5.59 -4.61 -8.53                                                       -6.53 -5.34 -6.67 -6.18 -5.50 -8.16 -7.96 -6.26 -10.84 KudlatyPredHuman 137
138 LOOPP_Server                                                       -4.20 -3.72 -4.85 -3.84 -3.56 -5.57 -5.59 -4.61 -8.53                                                       -6.53 -5.34 -6.67 -6.18 -5.50 -8.16 -7.96 -6.26 -10.84 LOOPP_Server 138
139 Linnolt−UH−CMB                                                       -4.20 -3.72 -4.85 -3.84 -3.56 -5.57 -5.59 -4.61 -8.53                                                       -6.53 -5.34 -6.67 -6.18 -5.50 -8.16 -7.96 -6.26 -10.84 Linnolt−UH−CMB 139
140 MeilerLabRene                                                       -4.20 -3.72 -4.85 -3.84 -3.56 -5.57 -5.59 -4.61 -8.53                                                       -6.53 -5.34 -6.67 -6.18 -5.50 -8.16 -7.96 -6.26 -10.84 MeilerLabRene 140
141 Nano_team                                                       -4.20 -3.72 -4.85 -3.84 -3.56 -5.57 -5.59 -4.61 -8.53                                                       -6.53 -5.34 -6.67 -6.18 -5.50 -8.16 -7.96 -6.26 -10.84 Nano_team 141
142 NirBenTal                                                       -4.20 -3.72 -4.85 -3.84 -3.56 -5.57 -5.59 -4.61 -8.53                                                       -6.53 -5.34 -6.67 -6.18 -5.50 -8.16 -7.96 -6.26 -10.84 NirBenTal 142
143 Ozkan−Shell                                                       -4.20 -3.72 -4.85 -3.84 -3.56 -5.57 -5.59 -4.61 -8.53                                                       -6.53 -5.34 -6.67 -6.18 -5.50 -8.16 -7.96 -6.26 -10.84 Ozkan−Shell 143
144 PHAISTOS                                                       -4.20 -3.72 -4.85 -3.84 -3.56 -5.57 -5.59 -4.61 -8.53                                                       -6.53 -5.34 -6.67 -6.18 -5.50 -8.16 -7.96 -6.26 -10.84 PHAISTOS 144
145 POISE                                                       -4.20 -3.72 -4.85 -3.84 -3.56 -5.57 -5.59 -4.61 -8.53                                                       -6.53 -5.34 -6.67 -6.18 -5.50 -8.16 -7.96 -6.26 -10.84 POISE 145
146 ProteinShop                                                       -4.20 -3.72 -4.85 -3.84 -3.56 -5.57 -5.59 -4.61 -8.53                                                       -6.53 -5.34 -6.67 -6.18 -5.50 -8.16 -7.96 -6.26 -10.84 ProteinShop 146
147 Pushchino                                                       -4.20 -3.72 -4.85 -3.84 -3.56 -5.57 -5.59 -4.61 -8.53                                                       -6.53 -5.34 -6.67 -6.18 -5.50 -8.16 -7.96 -6.26 -10.84 Pushchino 147
148 RPFM                                                       -4.20 -3.72 -4.85 -3.84 -3.56 -5.57 -5.59 -4.61 -8.53                                                       -6.53 -5.34 -6.67 -6.18 -5.50 -8.16 -7.96 -6.26 -10.84 RPFM 148
149 SAINT1                                                       -4.20 -3.72 -4.85 -3.84 -3.56 -5.57 -5.59 -4.61 -8.53                                                       -6.53 -5.34 -6.67 -6.18 -5.50 -8.16 -7.96 -6.26 -10.84 SAINT1 149
150 Scheraga                                                       -4.20 -3.72 -4.85 -3.84 -3.56 -5.57 -5.59 -4.61 -8.53                                                       -6.53 -5.34 -6.67 -6.18 -5.50 -8.16 -7.96 -6.26 -10.84 Scheraga 150
151 ShakAbInitio                                                       -4.20 -3.72 -4.85 -3.84 -3.56 -5.57 -5.59 -4.61 -8.53                                                       -6.53 -5.34 -6.67 -6.18 -5.50 -8.16 -7.96 -6.26 -10.84 ShakAbInitio 151
152 TsaiLab                                                       -4.20 -3.72 -4.85 -3.84 -3.56 -5.57 -5.59 -4.61 -8.53                                                       -6.53 -5.34 -6.67 -6.18 -5.50 -8.16 -7.96 -6.26 -10.84 TsaiLab 152
153 UCDavisGenome                                                       -4.20 -3.72 -4.85 -3.84 -3.56 -5.57 -5.59 -4.61 -8.53                                                       -6.53 -5.34 -6.67 -6.18 -5.50 -8.16 -7.96 -6.26 -10.84 UCDavisGenome 153
154 Wolfson−FOBIA                                                       -4.20 -3.72 -4.85 -3.84 -3.56 -5.57 -5.59 -4.61 -8.53                                                       -6.53 -5.34 -6.67 -6.18 -5.50 -8.16 -7.96 -6.26 -10.84 Wolfson−FOBIA 154
155 YASARA                                                       -4.20 -3.72 -4.85 -3.84 -3.56 -5.57 -5.59 -4.61 -8.53                                                       -6.53 -5.34 -6.67 -6.18 -5.50 -8.16 -7.96 -6.26 -10.84 YASARA 155
156 YASARARefine                                                       -4.20 -3.72 -4.85 -3.84 -3.56 -5.57 -5.59 -4.61 -8.53                                                       -6.53 -5.34 -6.67 -6.18 -5.50 -8.16 -7.96 -6.26 -10.84 YASARARefine 156
157 dill_ucsf                                                       -4.20 -3.72 -4.85 -3.84 -3.56 -5.57 -5.59 -4.61 -8.53                                                       -6.53 -5.34 -6.67 -6.18 -5.50 -8.16 -7.96 -6.26 -10.84 dill_ucsf 157
158 dill_ucsf_extended                                                       -4.20 -3.72 -4.85 -3.84 -3.56 -5.57 -5.59 -4.61 -8.53                                                       -6.53 -5.34 -6.67 -6.18 -5.50 -8.16 -7.96 -6.26 -10.84 dill_ucsf_extended 158
159 igor                                                       -4.20 -3.72 -4.85 -3.84 -3.56 -5.57 -5.59 -4.61 -8.53                                                       -6.53 -5.34 -6.67 -6.18 -5.50 -8.16 -7.96 -6.26 -10.84 igor 159
160 jacobson                                                       -4.20 -3.72 -4.85 -3.84 -3.56 -5.57 -5.59 -4.61 -8.53                                                       -6.53 -5.34 -6.67 -6.18 -5.50 -8.16 -7.96 -6.26 -10.84 jacobson 160
161 mumssp                                                       -4.20 -3.72 -4.85 -3.84 -3.56 -5.57 -5.59 -4.61 -8.53                                                       -6.53 -5.34 -6.67 -6.18 -5.50 -8.16 -7.96 -6.26 -10.84 mumssp 161
162 ricardo                                                       -4.20 -3.72 -4.85 -3.84 -3.56 -5.57 -5.59 -4.61 -8.53                                                       -6.53 -5.34 -6.67 -6.18 -5.50 -8.16 -7.96 -6.26 -10.84 ricardo 162
163 rivilo                                                       -4.20 -3.72 -4.85 -3.84 -3.56 -5.57 -5.59 -4.61 -8.53                                                       -6.53 -5.34 -6.67 -6.18 -5.50 -8.16 -7.96 -6.26 -10.84 rivilo 163
164 taylor                                                       -4.20 -3.72 -4.85 -3.84 -3.56 -5.57 -5.59 -4.61 -8.53                                                       -6.53 -5.34 -6.67 -6.18 -5.50 -8.16 -7.96 -6.26 -10.84 taylor 164
165 test_http_server_01                                                       -4.20 -3.72 -4.85 -3.84 -3.56 -5.57 -5.59 -4.61 -8.53                                                       -6.53 -5.34 -6.67 -6.18 -5.50 -8.16 -7.96 -6.26 -10.84 test_http_server_01 165
166 tripos_08                                                       -4.20 -3.72 -4.85 -3.84 -3.56 -5.57 -5.59 -4.61 -8.53                                                       -6.53 -5.34 -6.67 -6.18 -5.50 -8.16 -7.96 -6.26 -10.84 tripos_08 166