T0452

Targets
387 388 389 390
391 392 393 394
395 396 397 398
399 400 401 402
403 404 405 406
407 408 409 410
411 412 413 414
415 416 417 418
419 420 421 422
423 424 425 426
427 428 429 430
431 432 433 434
435 436 437 438
439 440 441 442
443 444 445 446
447 448 449 450
451 452 453 454
455 456 457 458
459 460 461 462
463 464 465 466
467 468 469 470
471 472 473 474
475 476 477 478
479 480 481 482
483 484 485 486
487 488 489 490
491 492 493 494
495 496 497 498
499 500 501 502
503 504 505 506
507 508 509 510
511 512 513 514

T0452

putative homoserine dehydrogenase (NP_069768.1) from Archaeoglobus fulgidus

Target type: Server only

Target sequence:

>T0452 NP_069768.1, ARCHAEOGLOBUS FULGIDUS, 326 residues
MIKIAIVGFGTVGQGVAELLIRKREEIEKAIGEFKVTAVADSKSSISGDFSLVEALRMKRETGMLRDDAKAIEVVRSADYDVLIEASVTRVDGGEGVNYIREALKRGKHVVTSNKGPLVAEFHGLMSLAERNGVRLMYEATVGGAMPVVKLAKRYLALCEIESVKGIFNGTCNYILSRMEEERLPYEHILKEAQELGYAEADPSYDVEGIDAALKLVIIANTIGVKASYEDVEVTGITQITPEAFQVAAEKGYTIRLIAEVSREKLKVSPRLVPFHHPLAIKGTMNAAMFKTDTAGSIFVAGRGAGKEETASAILSDLYEIYAGPR

Structure:
Method: X-ray, res=2.2Å, R/Rfree=0.19/0.22
Determined by: JCSG
PDB ID: 3do5

3do5_A cartoon
Cartoon diagram of 452: 3do5 chain A

PyMOL of 3do5

Domains:  PyMOL of domains

Two domains. Residue ranges in PDB: 1-144,304-324 and 145-303. Residue ranges in target: 1-144,304-324 and 145-303.

452 domain evaluation plot
Correlation between weighted by the number of residues sum of GDT-TS scores for domain-based evlatuation (y, vertical axis) and whole chain GDT-TS (x, horizontal axis).

To compute the weighted sum, GDT-TS for each domain was multiplied by the domain length, and this sum was divided by the sum of domain lengths. Each point represents first server model. Green, gray and black points are top 10, bottom 25% and the rest of prediction models. Blue line is the best-fit slope line (intersection 0) to the top 10 server models. Red line is the diagonal. Slope and root mean square y-x distance for the top 10 models (average difference between the weighted sum of domain GDT-TS scores and the whole chain GDT-TS score) are shown above the plot.

Structure classification:

N-domain: NAD(P)-binding Rossmann fold. C-domain: FwdE/GAPDH domain-like fold.

CASP category:

Whole chain: Comparative modeling:easy.

1st domain: Comparative modeling:easy. 2nd domain: Comparative modeling:easy.

Closest templates:

2ejw.

Target sequence - PDB file inconsistencies:

T0452    3do5.pdb    T0452.pdb    PyMOL    PyMOL of domains    

T0452    1 MIKIAIVGFGTVGQGVAELLIRKREEIEKAIGEFKVTAVADSKSSISGDFSLVEALRMKRETGMLRDDAKAIEVVRSADYDVLIEASVTRVDGGEGVNYIREALKRGKHVVTSNKGPLVAEFHGLMSLAERNGVRLMYEATVGGAMPVVKLAKRYLALCEIESVKGIFNGTCNYILSRMEEERLPYEHILKEAQELGYAEADPSYDVEGIDAALKLVIIANTIGVKASYEDVEVTGITQITPEAFQVAAEKGYTIRLIAEVSREKLKVSPRLVPFHHPLAIKGTMNAAMFKTDTAGSIFVAGRGAGKEETASAILSDLYEIYAGPR 326
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~
3do5A    1 MIKIAIVGFGTVGQGVAELLIRKREEIEKAIGEFKVTAVADSKSSISGDFSLVEALRMKRETGMLRDDAKAIEVVRSADYDVLIEASVTR----EGVNYIREALKRGKHVVTSNKGPLVAEFHGLMSLAERNGVRLMYEATVGGAMPVVKLAKRYLALCEIESVKGIFNGTCNYILSRMEEERLPYEHILKEAQELGYAEADPSYDVEGIDAALKLVIIANTIGVKASYEDVEVTGITQITPEAFQVAAEKGYTIRLIAEVSREKLKVSPRLVPFHHPLAIKGTMNAAMFKTDTAGSIFVAGRGAGKEETASAILSDLYEIYAG-- 324

Residue change log: change 1, 58, 64, 126, 137, 146, 179, 285, 289, MSE to MET;

We suggest to evaluate this target as a single domain spanning whole chain. However, evolutionarily this is a 2-domain protein:

1st domain: target 1-90, 95-144, 304-324 ; pdb 1-90, 95-144, 304-324

2nd domain: target 145-303 ; pdb 145-303

Sequence classification:

N-domain: Homoserine dehydrogenase, NAD binding (NAD_binding_3), C-domain:Homoserine dehydrogenase (Homoserine_dh) in Pfam.

Server predictions:

T0452:pdb 1-324:seq 1-324:CM_easy;   alignment

distribution of first scores
First models for T0452: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

452_1:pdb 1-144,304-324:seq 1-144,304-324:CM_easy;   alignment

distribution of first scores
First models for T0452_1: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

452_2:pdb 145-303:seq 145-303:CM_easy;   alignment

distribution of first scores
First models for T0452_2: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

# GROUP ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ ↓ GROUP #
T0452 452_1 452_2 T0452 452_1 452_2 T0452 452_1 452_2 T0452 452_1 452_2
First score First Z-score Best score Best Z-score
1 MUProt 83.83 78.05 84.31 84.47 80.02 78.95 93.40 91.93 91.43 1.41 1.55 1.15 1.44 1.43 1.27 0.96 1.18 0.91 84.61 78.05 84.51 84.63 80.59 79.18 93.55 91.93 91.61 1.58 1.59 1.14 1.16 1.18 0.98 0.84 1.03 0.81 MUProt 1
2 LEE−SERVER 83.44 77.81 83.42 84.16 80.95 78.74 92.30 90.20 89.86 1.37 1.52 1.07 1.41 1.51 1.25 0.86 1.04 0.80 85.39 81.85 83.70 84.78 80.95 78.93 92.61 90.51 90.26 1.67 2.03 1.07 1.17 1.21 0.96 0.75 0.90 0.70 LEE−SERVER 2
3 MULTICOM−CLUSTER 83.28 79.69 83.89 83.23 80.44 78.03 91.51 89.83 91.48 1.36 1.70 1.11 1.32 1.46 1.18 0.79 1.01 0.92 83.28 79.92 83.89 83.23 80.44 78.92 93.24 92.19 91.48 1.42 1.80 1.09 1.00 1.16 0.96 0.81 1.05 0.80 MULTICOM−CLUSTER 3
4 MULTICOM−REFINE 83.05 78.78 83.30 83.85 81.26 78.09 92.14 89.41 90.27 1.34 1.62 1.06 1.38 1.54 1.19 0.84 0.98 0.83 84.53 78.78 84.53 84.47 81.26 79.14 93.24 91.77 91.66 1.57 1.67 1.14 1.14 1.24 0.98 0.81 1.01 0.81 MULTICOM−REFINE 4
5 Phyre_de_novo 82.81 78.59 82.80 83.70 79.04 78.23 91.35 89.05 89.22 1.31 1.60 1.02 1.36 1.34 1.20 0.77 0.95 0.75 82.81 78.59 82.80 83.70 79.04 78.23 91.35 89.05 89.22 1.36 1.65 0.99 1.05 1.01 0.88 0.63 0.78 0.62 Phyre_de_novo 5
6 MULTICOM−RANK 82.42 77.06 83.63 83.23 78.78 79.05 92.77 83.33 90.09 1.27 1.45 1.09 1.32 1.32 1.28 0.90 0.50 0.81 82.42 77.06 83.63 83.23 78.78 79.05 92.77 85.38 90.09 1.32 1.47 1.06 1.00 0.99 0.97 0.77 0.46 0.69 MULTICOM−RANK 6
7 RAPTOR 82.03 77.14 83.23 84.01 79.66 80.49 90.72 88.52 88.85 1.24 1.46 1.06 1.40 1.40 1.42 0.72 0.91 0.72 82.27 77.14 84.19 85.09 80.80 80.96 91.67 89.67 89.07 1.30 1.48 1.11 1.21 1.20 1.17 0.66 0.83 0.61 RAPTOR 7
8 Zhang−Server 81.48 75.50 82.29 80.90 77.38 77.14 92.14 85.11 89.20 1.18 1.30 0.98 1.08 1.19 1.10 0.84 0.64 0.75 82.03 75.50 82.86 82.76 78.52 78.59 92.45 90.04 89.20 1.27 1.29 0.99 0.94 0.96 0.92 0.74 0.86 0.62 Zhang−Server 8
9 METATASSER 80.78 74.38 80.85 79.97 76.14 75.63 91.98 89.78 88.59 1.12 1.19 0.87 0.99 1.08 0.95 0.83 1.01 0.70 81.48 74.38 80.85 84.01 80.38 78.47 91.98 90.20 88.59 1.21 1.16 0.81 1.09 1.15 0.91 0.69 0.88 0.57 METATASSER 9
10 BioSerf 79.53 70.62 82.99 84.16 79.40 80.96 89.47 82.55 86.82 0.99 0.83 1.04 1.41 1.37 1.47 0.61 0.43 0.57 79.53 70.62 82.99 84.16 79.40 80.96 89.47 82.55 86.82 0.97 0.72 1.01 1.10 1.05 1.17 0.44 0.21 0.43 BioSerf 10
11 FEIG 79.30 70.65 76.66 76.40 70.39 73.12 88.21 85.80 83.14 0.97 0.83 0.53 0.62 0.58 0.71 0.49 0.69 0.29 79.30 70.65 76.66 76.40 70.39 73.12 88.36 85.80 83.14 0.95 0.72 0.44 0.21 0.12 0.35 0.33 0.49 0.13 FEIG 11
12 Fiser−M4T 79.22 72.19 81.46 82.92 77.54 77.27 86.95 81.81 87.75 0.96 0.98 0.92 1.28 1.21 1.11 0.38 0.38 0.64 79.22 72.19 81.46 82.92 77.54 77.27 86.95 81.81 87.75 0.94 0.90 0.87 0.96 0.86 0.78 0.20 0.15 0.50 Fiser−M4T 12
13 MULTICOM−CMFR 77.89 72.53 80.08 82.92 77.02 77.44 86.95 81.50 84.57 0.84 1.01 0.80 1.28 1.16 1.13 0.38 0.35 0.40 83.91 80.05 83.33 82.92 78.73 77.53 92.30 84.54 90.94 1.50 1.82 1.04 0.96 0.98 0.81 0.72 0.38 0.76 MULTICOM−CMFR 13
14 pro−sp3−TASSER 76.64 69.48 75.71 77.80 71.79 71.23 88.52 83.18 83.24 0.72 0.72 0.45 0.77 0.70 0.53 0.52 0.48 0.30 80.94 74.58 82.21 80.28 77.69 77.56 93.55 92.19 90.61 1.14 1.18 0.94 0.66 0.87 0.81 0.84 1.05 0.73 pro−sp3−TASSER 14
15 PS2−server 76.41 64.43 78.44 77.95 69.82 73.71 89.62 85.22 85.89 0.69 0.23 0.67 0.78 0.53 0.77 0.62 0.65 0.50 76.41 64.43 78.44 79.97 75.41 76.38 89.62 85.22 85.89 0.60 -0.01 0.60 0.62 0.64 0.69 0.46 0.44 0.35 PS2−server 15
16 pipe_int 75.16 65.52 77.18 80.90 76.76 77.18 83.33 76.62 80.89 0.57 0.34 0.57 1.08 1.14 1.10 0.06 -0.03 0.12 75.16 65.52 77.18 80.90 76.76 77.18 83.33 76.62 80.89 0.45 0.12 0.49 0.73 0.78 0.77 -0.16 -0.31 -0.05 pipe_int 16
17 SAM−T08−server 74.53 66.15 76.87 81.68 77.43 78.35 79.40 67.56 79.11 0.51 0.40 0.55 1.16 1.20 1.22 -0.29 -0.75 -0.02 74.53 66.15 76.87 81.68 77.43 78.35 85.69 81.50 79.64 0.38 0.20 0.46 0.82 0.85 0.90 0.07 0.12 -0.15 SAM−T08−server 17
18 GS−MetaServer2 72.50 63.54 73.66 66.77 61.39 64.03 89.62 76.36 86.91 0.31 0.15 0.29 -0.35 -0.22 -0.17 0.62 -0.06 0.57 72.50 63.54 73.66 80.75 74.12 75.64 89.62 76.36 86.91 0.14 -0.11 0.17 0.71 0.50 0.61 0.46 -0.33 0.43 GS−MetaServer2 18
19 forecast 72.11 61.04 73.80 80.75 76.81 77.10 78.46 71.02 73.80 0.28 -0.10 0.30 1.06 1.14 1.09 -0.37 -0.48 -0.42 73.44 67.19 74.22 81.68 76.81 77.23 88.52 86.11 86.85 0.25 0.32 0.22 0.82 0.78 0.78 0.35 0.52 0.43 forecast 19
20 3DShot2 72.03 63.28 72.94 79.35 74.38 75.83 77.99 73.48 73.53 0.27 0.12 0.23 0.92 0.93 0.97 -0.42 -0.28 -0.44 72.03 63.28 72.94 79.35 74.38 75.83 77.99 73.48 73.53 0.08 -0.14 0.11 0.55 0.53 0.63 -0.68 -0.58 -0.64 3DShot2 20
21 GS−KudlatyPred 71.95 63.67 72.77 80.44 75.26 76.39 77.36 71.38 72.48 0.26 0.16 0.21 1.03 1.01 1.03 -0.47 -0.45 -0.52 71.95 63.67 72.77 80.44 75.26 76.39 77.36 71.38 72.48 0.07 -0.09 0.10 0.68 0.62 0.69 -0.74 -0.76 -0.72 GS−KudlatyPred 21
22 fais−server 71.72 63.96 74.19 82.14 78.42 77.52 77.36 70.23 74.20 0.24 0.19 0.33 1.21 1.29 1.14 -0.47 -0.54 -0.39 71.72 64.53 74.60 82.14 78.42 77.52 89.47 85.69 87.81 0.05 0.01 0.26 0.87 0.95 0.81 0.44 0.48 0.51 fais−server 22
23 MUSTER 71.17 64.40 74.17 68.32 63.15 64.55 90.88 88.68 86.77 0.19 0.23 0.33 -0.19 -0.06 -0.12 0.73 0.92 0.56 72.19 65.05 74.17 78.26 72.98 71.99 90.88 88.68 86.77 0.10 0.07 0.22 0.43 0.39 0.23 0.58 0.74 0.42 MUSTER 23
24 COMA−M 70.94 63.65 75.04 68.32 62.63 66.58 89.47 80.08 86.62 0.16 0.16 0.40 -0.19 -0.11 0.08 0.61 0.24 0.55 74.22 68.02 76.16 70.50 64.80 67.26 90.57 87.84 88.12 0.34 0.41 0.40 -0.46 -0.46 -0.26 0.55 0.67 0.53 COMA−M 24
25 keasar−server 70.70 64.40 72.77 68.17 63.51 63.14 88.05 83.12 85.08 0.14 0.23 0.21 -0.21 -0.03 -0.25 0.48 0.48 0.43 71.02 64.40 74.50 75.62 70.96 72.64 89.15 85.90 87.41 -0.04 -0.01 0.25 0.12 0.18 0.30 0.41 0.50 0.47 keasar−server 25
26 YASARA 70.55 62.89 66.64 81.52 78.62 78.37 72.96 67.72 57.34 0.13 0.08 -0.28 1.14 1.30 1.22 -0.86 -0.74 -1.66 70.55 63.05 66.64 81.52 78.62 78.37 72.96 67.72 57.34 -0.09 -0.17 -0.45 0.80 0.97 0.90 -1.18 -1.08 -1.94 YASARA 26
27 HHpred2 69.92 62.87 73.82 69.10 64.96 64.08 89.78 84.49 86.78 0.06 0.08 0.30 -0.12 0.10 -0.16 0.63 0.59 0.56 69.92 62.87 73.82 69.10 64.96 64.08 89.78 84.49 86.78 -0.17 -0.19 0.19 -0.62 -0.44 -0.59 0.47 0.38 0.42 HHpred2 27
28 PSI 69.84 62.45 71.14 75.00 70.24 72.20 77.52 68.08 73.61 0.06 0.04 0.08 0.48 0.56 0.62 -0.46 -0.71 -0.43 70.62 65.21 72.70 75.00 70.24 72.20 88.99 86.06 86.73 -0.09 0.09 0.09 0.05 0.10 0.26 0.40 0.52 0.42 PSI 28
29 HHpred4 69.69 63.78 73.94 68.17 62.06 63.42 89.47 82.70 88.04 0.04 0.17 0.31 -0.21 -0.16 -0.23 0.61 0.45 0.66 69.69 63.78 73.94 68.17 62.06 63.42 89.47 82.70 88.04 -0.20 -0.08 0.20 -0.73 -0.75 -0.66 0.44 0.22 0.52 HHpred4 29
30 HHpred5 69.69 63.78 73.94 68.17 62.06 63.42 89.47 82.70 88.04 0.04 0.17 0.31 -0.21 -0.16 -0.23 0.61 0.45 0.66 69.69 63.78 73.94 68.17 62.06 63.42 89.47 82.70 88.04 -0.20 -0.08 0.20 -0.73 -0.75 -0.66 0.44 0.22 0.52 HHpred5 30
31 COMA 69.61 63.93 73.52 67.39 62.11 63.35 88.84 80.40 87.40 0.03 0.18 0.28 -0.29 -0.16 -0.23 0.55 0.26 0.61 72.42 65.65 76.16 80.90 76.76 77.16 88.84 85.33 88.12 0.13 0.14 0.40 0.73 0.78 0.77 0.38 0.45 0.53 COMA 31
32 GeneSilicoMetaServer 69.61 62.68 70.21 63.98 57.87 61.97 85.85 81.66 81.56 0.03 0.06 0.01 -0.63 -0.53 -0.37 0.28 0.36 0.17 72.50 63.54 73.66 66.77 61.39 64.03 89.62 85.53 86.94 0.14 -0.11 0.17 -0.89 -0.81 -0.60 0.46 0.47 0.44 GeneSilicoMetaServer 32
33 FFASstandard 69.45 60.29 72.66 66.15 54.45 62.21 87.89 83.81 86.38 0.02 -0.17 0.21 -0.41 -0.83 -0.34 0.47 0.53 0.53 69.45 62.42 72.66 75.78 71.07 72.31 87.89 83.81 86.38 -0.22 -0.24 0.09 0.14 0.19 0.27 0.29 0.32 0.39 FFASstandard 33
34 FFASflextemplate 69.45 60.29 72.66 66.15 54.45 62.21 87.89 83.81 86.38 0.02 -0.17 0.21 -0.41 -0.83 -0.34 0.47 0.53 0.53 70.78 64.82 72.66 66.15 61.18 62.21 87.89 83.81 86.38 -0.07 0.04 0.09 -0.96 -0.84 -0.79 0.29 0.32 0.39 FFASflextemplate 34
35 Frankenstein 69.30 61.48 68.43 65.22 56.73 60.75 78.62 69.08 78.45 0.00 -0.05 -0.14 -0.51 -0.63 -0.48 -0.36 -0.63 -0.07 71.09 64.27 73.40 80.12 75.88 76.07 79.56 72.22 78.45 -0.03 -0.02 0.15 0.64 0.69 0.66 -0.53 -0.69 -0.25 Frankenstein 35
36 SAM−T06−server 68.83 59.38 71.43 75.62 69.20 70.82 78.46 74.69 76.58 -0.04 -0.26 0.11 0.55 0.47 0.49 -0.37 -0.19 -0.21 68.83 60.96 71.43 77.64 70.60 73.39 81.76 76.42 76.58 -0.30 -0.41 -0.02 0.36 0.14 0.38 -0.31 -0.32 -0.40 SAM−T06−server 36
37 Pcons_local 68.67 59.35 70.52 73.91 66.77 71.07 77.20 72.59 73.63 -0.06 -0.26 0.03 0.37 0.26 0.51 -0.49 -0.35 -0.43 70.86 64.14 71.40 78.73 76.24 72.67 78.14 74.06 73.70 -0.06 -0.04 -0.03 0.48 0.72 0.30 -0.67 -0.53 -0.63 Pcons_local 37
38 FAMSD 68.67 58.83 71.07 65.06 58.02 60.48 88.68 85.74 85.10 -0.06 -0.31 0.08 -0.52 -0.52 -0.51 0.54 0.69 0.44 69.22 63.15 71.14 76.55 72.41 71.00 88.68 85.74 85.10 -0.25 -0.15 -0.05 0.23 0.33 0.13 0.37 0.49 0.29 FAMSD 38
39 BAKER−ROBETTA 68.59 61.56 72.91 65.84 60.66 64.92 85.69 79.51 83.98 -0.06 -0.05 0.23 -0.45 -0.28 -0.08 0.27 0.19 0.35 70.08 63.12 74.53 68.01 62.06 67.70 87.58 81.34 87.16 -0.15 -0.16 0.25 -0.75 -0.75 -0.21 0.26 0.11 0.45 BAKER−ROBETTA 39
40 Pcons_dot_net 68.52 60.88 73.65 66.30 59.47 62.32 89.15 86.53 88.67 -0.07 -0.11 0.29 -0.40 -0.39 -0.33 0.58 0.75 0.71 70.47 64.77 73.65 68.32 59.47 62.32 90.25 86.53 88.67 -0.10 0.03 0.17 -0.71 -1.01 -0.78 0.52 0.56 0.57 Pcons_dot_net 40
41 Pcons_multi 68.52 60.88 73.65 66.30 59.47 62.32 89.15 86.53 88.67 -0.07 -0.11 0.29 -0.40 -0.39 -0.33 0.58 0.75 0.71 77.03 67.97 78.19 73.91 64.08 68.12 94.03 87.32 90.85 0.68 0.41 0.58 -0.07 -0.54 -0.17 0.89 0.63 0.75 Pcons_multi 41
42 FUGUE_KM 68.28 62.45 69.06 65.22 58.59 58.36 87.11 84.07 83.43 -0.09 0.04 -0.08 -0.51 -0.47 -0.72 0.40 0.56 0.31 68.28 62.45 69.06 65.22 58.59 58.36 87.11 84.07 83.43 -0.36 -0.24 -0.23 -1.07 -1.10 -1.19 0.21 0.34 0.15 FUGUE_KM 42
43 nFOLD3 68.28 62.40 68.78 65.22 54.35 57.69 87.11 84.28 83.57 -0.09 0.04 -0.11 -0.51 -0.84 -0.78 0.40 0.57 0.32 70.00 62.50 70.00 77.95 72.77 73.88 87.11 84.28 83.57 -0.16 -0.23 -0.15 0.39 0.36 0.43 0.21 0.36 0.17 nFOLD3 43
44 circle 68.12 60.23 72.02 64.60 58.90 63.18 88.21 84.96 84.12 -0.11 -0.17 0.15 -0.57 -0.44 -0.25 0.49 0.63 0.36 68.52 60.70 72.02 65.37 59.52 63.18 88.36 84.96 84.88 -0.34 -0.44 0.03 -1.05 -1.01 -0.69 0.33 0.42 0.27 circle 44
45 mGenTHREADER 68.05 61.80 67.41 64.44 58.54 57.08 87.58 83.07 81.23 -0.12 -0.02 -0.22 -0.59 -0.47 -0.84 0.44 0.48 0.14 68.05 61.80 67.41 64.44 58.54 57.08 87.58 83.07 81.23 -0.39 -0.31 -0.38 -1.16 -1.11 -1.32 0.26 0.26 -0.02 mGenTHREADER 45
46 panther_server 67.81 59.79 61.09 64.91 53.93 54.85 75.63 63.89 69.62 -0.14 -0.22 -0.73 -0.54 -0.88 -1.05 -0.63 -1.04 -0.73 69.92 62.27 68.38 78.26 71.95 71.28 86.48 81.34 83.76 -0.17 -0.26 -0.30 0.43 0.28 0.16 0.15 0.11 0.18 panther_server 46
47 Phyre2 67.58 60.76 73.95 66.92 60.20 64.71 84.75 78.25 86.61 -0.16 -0.12 0.31 -0.34 -0.32 -0.10 0.19 0.09 0.55 71.33 63.93 74.36 80.28 73.86 76.76 84.75 78.25 86.61 -0.00 -0.06 0.24 0.66 0.48 0.73 -0.02 -0.16 0.41 Phyre2 47
48 Poing 67.19 60.21 76.01 67.24 58.95 68.66 84.75 78.25 86.61 -0.20 -0.18 0.48 -0.30 -0.43 0.28 0.19 0.09 0.55 71.48 63.93 76.01 79.81 73.39 76.86 84.75 78.25 86.61 0.02 -0.06 0.38 0.60 0.43 0.74 -0.02 -0.16 0.41 Poing 48
49 Phragment 67.11 60.13 75.53 66.46 58.75 67.73 84.75 78.25 86.61 -0.21 -0.18 0.44 -0.38 -0.45 0.19 0.19 0.09 0.55 71.41 63.93 75.53 80.28 73.86 76.94 84.75 78.25 86.61 0.01 -0.06 0.34 0.66 0.48 0.75 -0.02 -0.16 0.41 Phragment 49
50 FALCON_CONSENSUS 67.11 59.92 71.86 65.37 55.23 61.06 88.05 85.85 86.98 -0.21 -0.20 0.14 -0.49 -0.76 -0.45 0.48 0.70 0.58 71.17 66.02 74.14 77.48 73.86 72.58 90.41 85.85 87.46 -0.02 0.18 0.22 0.34 0.48 0.29 0.54 0.50 0.48 FALCON_CONSENSUS 50
51 FALCON 67.11 59.92 71.86 65.37 55.23 61.06 88.05 85.85 86.98 -0.21 -0.20 0.14 -0.49 -0.76 -0.45 0.48 0.70 0.58 71.17 66.02 74.14 77.48 73.86 72.58 90.41 85.85 87.46 -0.02 0.18 0.22 0.34 0.48 0.29 0.54 0.50 0.48 FALCON 51
52 FFASsuboptimal 66.95 56.88 70.79 66.15 56.16 59.60 87.89 83.91 85.33 -0.22 -0.50 0.06 -0.41 -0.68 -0.60 0.47 0.54 0.45 68.28 62.94 71.37 66.15 56.78 61.11 87.89 85.38 85.89 -0.36 -0.18 -0.03 -0.96 -1.29 -0.90 0.29 0.46 0.35 FFASsuboptimal 52
53 SAM−T02−server 65.62 60.62 58.87 58.08 55.18 42.21 85.85 81.55 79.75 -0.35 -0.14 -0.91 -1.23 -0.77 -2.27 0.28 0.36 0.03 67.73 60.62 58.87 60.71 56.78 49.19 85.85 81.55 79.75 -0.43 -0.45 -1.14 -1.58 -1.29 -2.14 0.09 0.12 -0.14 SAM−T02−server 53
54 Pushchino 65.31 59.63 60.55 58.23 49.74 46.30 83.65 80.19 80.03 -0.38 -0.23 -0.77 -1.22 -1.25 -1.88 0.09 0.25 0.05 65.31 59.63 60.55 58.23 49.74 46.30 83.65 80.19 80.03 -0.72 -0.57 -0.99 -1.87 -2.02 -2.45 -0.13 0.01 -0.12 Pushchino 54
55 Distill 62.03 56.62 57.48 63.51 51.66 61.46 65.41 60.80 57.11 -0.70 -0.52 -1.02 -0.68 -1.08 -0.42 -1.54 -1.29 -1.68 62.42 56.62 58.45 68.63 62.84 64.05 65.41 60.80 57.11 -1.06 -0.92 -1.18 -0.68 -0.66 -0.59 -1.92 -1.68 -1.96 Distill 55
56 CpHModels 61.02 52.60 57.26 52.17 48.34 43.07 83.65 74.84 75.84 -0.80 -0.91 -1.04 -1.83 -1.37 -2.19 0.09 -0.18 -0.26 61.02 52.60 57.26 52.17 48.34 43.07 83.65 74.84 75.84 -1.23 -1.39 -1.29 -2.56 -2.17 -2.78 -0.13 -0.46 -0.45 CpHModels 56
57 3Dpro 56.95 49.19 49.58 63.20 52.33 59.71 55.35 45.91 44.30 -1.19 -1.24 -1.65 -0.71 -1.02 -0.58 -2.43 -2.47 -2.64 57.19 49.19 49.65 63.51 53.67 59.71 55.35 46.17 44.30 -1.68 -1.79 -1.96 -1.26 -1.61 -1.05 -2.90 -2.95 -2.98 3Dpro 57
58 MUFOLD−Server 53.91 45.10 45.02 64.29 57.87 56.27 53.62 44.92 39.23 -1.48 -1.63 -2.02 -0.60 -0.53 -0.92 -2.58 -2.54 -3.03 54.22 45.94 45.75 64.29 57.87 56.80 54.87 49.00 41.07 -2.04 -2.17 -2.31 -1.17 -1.18 -1.35 -2.95 -2.71 -3.24 MUFOLD−Server 58
59 ACOMPMOD 52.66 45.16 48.74 58.08 53.52 52.36 52.67 41.25 47.73 -1.60 -1.63 -1.72 -1.23 -0.91 -1.29 -2.67 -2.84 -2.39 52.66 45.16 48.74 58.08 53.52 52.36 52.67 41.25 47.73 -2.22 -2.26 -2.04 -1.89 -1.63 -1.81 -3.17 -3.38 -2.71 ACOMPMOD 59
60 LOOPP_Server 38.36 36.07 21.24 1.86 1.86 -18.62 75.63 71.02 75.41 -2.99 -2.51 -3.94 -6.93 -5.48 -8.15 -0.63 -0.48 -0.30 68.98 61.98 72.21 76.86 72.31 73.15 90.25 85.74 85.69 -0.28 -0.29 0.05 0.27 0.32 0.35 0.52 0.49 0.34 LOOPP_Server 60
61 rehtnap 34.06 29.01 27.79 33.54 27.74 32.61 44.97 37.53 30.34 -3.40 -3.19 -3.41 -3.72 -3.19 -3.20 -3.35 -3.13 -3.70 47.66 41.72 30.34 55.90 50.10 39.46 44.97 37.53 30.49 -2.82 -2.66 -3.68 -2.14 -1.98 -3.16 -3.92 -3.70 -4.09 rehtnap 61
62 3D−JIGSAW_AEP 30.70 23.33 27.83 51.71 42.55 48.99 15.72 12.89 15.99 -3.73 -3.74 -3.41 -1.88 -1.88 -1.62 -5.96 -5.08 -4.78 30.70 24.22 27.83 51.71 42.55 48.99 15.72 13.00 16.05 -4.83 -4.70 -3.90 -2.62 -2.77 -2.17 -6.79 -5.84 -5.25 3D−JIGSAW_AEP 62
63 3D−JIGSAW_V3 26.64 22.47 30.76 43.79 35.40 44.97 26.89 23.11 24.93 -4.12 -3.82 -3.17 -2.68 -2.52 -2.01 -4.96 -4.27 -4.11 26.64 22.47 30.76 43.79 35.45 44.97 26.89 23.11 24.93 -5.32 -4.91 -3.64 -3.52 -3.50 -2.58 -5.70 -4.96 -4.54 3D−JIGSAW_V3 63
64 FOLDpro 22.81 17.79 21.22 43.79 35.09 40.71 12.74 9.70 11.55 -4.49 -4.27 -3.94 -2.68 -2.54 -2.42 -6.22 -5.33 -5.12 25.16 19.66 24.75 48.76 38.82 47.06 16.82 15.46 14.20 -5.49 -5.24 -4.18 -2.95 -3.15 -2.37 -6.68 -5.62 -5.40 FOLDpro 64
65 mariner1 22.66 19.53 7.87 1.86 1.86 -18.63 44.50 38.00 47.62 -4.51 -4.10 -5.02 -6.93 -5.48 -8.15 -3.40 -3.09 -2.39 40.16 36.25 23.76 37.27 31.26 38.32 79.09 71.23 77.77 -3.71 -3.30 -4.27 -4.27 -3.94 -3.28 -0.57 -0.77 -0.30 mariner1 65
66 OLGAFS 14.38 10.26 2.55 26.09 20.81 13.00 10.38 6.92 3.54 -5.31 -5.00 -5.45 -4.47 -3.80 -5.10 -6.43 -5.55 -5.72 14.77 12.40 2.55 26.71 21.95 13.01 10.38 7.18 3.64 -6.73 -6.08 -6.15 -5.48 -4.90 -5.92 -7.32 -6.34 -6.25 OLGAFS 66
67 MUFOLD−MD 10.55 7.84 24.97 16.30 14.44 29.31 19.50 14.05 31.36 -5.68 -5.23 -3.64 -5.47 -4.37 -3.52 -5.62 -4.99 -3.62 12.19 9.63 28.57 20.03 17.34 34.28 19.50 16.82 35.11 -7.04 -6.41 -3.84 -6.25 -5.38 -3.70 -6.42 -5.50 -3.72 MUFOLD−MD 67
68 RBO−Proteus 10.31 8.59 29.61 20.50 17.08 37.95 16.20 13.05 31.62 -5.70 -5.16 -3.26 -5.04 -4.13 -2.69 -5.91 -5.07 -3.60 12.27 10.60 29.70 22.83 18.12 38.23 17.77 15.78 32.15 -7.03 -6.30 -3.74 -5.92 -5.30 -3.29 -6.59 -5.59 -3.96 RBO−Proteus 68
69 RANDOM 8.85 7.15 8.85 16.53 13.94 16.53 13.17 11.52 13.17 -5.84 -5.30 -4.94 -5.44 -4.41 -4.75 -6.18 -5.19 -5.00 8.85 7.15 8.85 16.53 13.94 16.53 13.17 11.52 13.17 -7.43 -6.70 -5.59 -6.65 -5.73 -5.55 -7.04 -5.96 -5.48 RANDOM 69
70 schenk−torda−server 6.02 5.03 5.67 11.18 9.68 13.03 11.63 9.43 9.03 -6.12 -5.50 -5.19 -5.98 -4.79 -5.09 -6.32 -5.35 -5.31 7.11 6.28 7.12 12.58 10.97 14.00 13.21 11.43 12.24 -7.64 -6.80 -5.75 -7.10 -6.04 -5.81 -7.04 -5.97 -5.56 schenk−torda−server 70
71 BHAGEERATH                                                       -5.84 -5.30 -4.94 -5.44 -4.41 -4.75 -6.18 -5.19 -5.00                                                       -7.43 -6.70 -5.59 -6.65 -5.73 -5.55 -7.04 -5.96 -5.48 BHAGEERATH 71
72 huber−torda−server                                                       -5.84 -5.30 -4.94 -5.44 -4.41 -4.75 -6.18 -5.19 -5.00                                                       -7.43 -6.70 -5.59 -6.65 -5.73 -5.55 -7.04 -5.96 -5.48 huber−torda−server 72
73 mahmood−torda−server                                                       -5.84 -5.30 -4.94 -5.44 -4.41 -4.75 -6.18 -5.19 -5.00                                                       -7.43 -6.70 -5.59 -6.65 -5.73 -5.55 -7.04 -5.96 -5.48 mahmood−torda−server 73
74 test_http_server_01                                                       -5.84 -5.30 -4.94 -5.44 -4.41 -4.75 -6.18 -5.19 -5.00                                                       -7.43 -6.70 -5.59 -6.65 -5.73 -5.55 -7.04 -5.96 -5.48 test_http_server_01 74