T0473

protein A3DK08 from Clostridium thermocellum

Target type: Human/Server

Target sequence:

>T0473 CmR9, Clostridium thermocellum, 68 residues
MKITKDMIIADVLQMDRGTAPIFINNGMHCLGCPSSMGESIEDACAVHGIDADKLVKELNEYFEKKEV

Structure:

Method: NMR

Determined by: NESG

PDB ID: 2k53

jumping through 473 NMR models
Jumping through 20 NMR models of 2k53

all 20 473 NMR models
All 20 superimposed NMR models of 2k53

PyMOL of 2k53

Domains: PyMOL of domains

Single domain protein. Unfortunately, the most interesting region (differing from the template) is conformationally flexible in the middle (green in the image above) of this NMR structure, and some residues from it were removed from NMR models for evaluation of predictions.

Structure classification:

An unusual helix-turn-helix (HTH) containing protein. The last two α-helices (yellow and orange-red) form the HTH motif, which is readily recognizable by almost perpendicular orientation of the two helices and a long extended "turn" between them that positions the N-terminus of the second helix close to the middle of the first helix. The rest of the structure is unique and shared only with the closest homologs: T0469 and the only full-chain template 2fi0. This N-terminal segment is structured as 3 helices and completes the HTH core in a manner similar to how a single N-terminal helix packs agaist HTH in a classic three-helical bundle fold.

2k53_1_ribbon
Ribbon diagram of T0473: 2k53 model 1

2k53 _1_1_67_ribbon
View of T0473 from the opposite side, residues 1 to 67

We used COMPASS to find homologs of T0473. The first COMPASS hit in the SCOP database is to a typical HTH three-helical bundle. Reasonably small E-value of ~0.03 is almost good enough to validate this match.

Subject = d1hcra_   a.4.1.2  HIN recombinase (DNA-binding domain)
length=52 filtered_length=51 Neff=12.765 Smith-Waterman score = 48 Evalue = 2.80e-02
QUERY         21     PIFINNGMHCLGCPSSMGESIEDACAVHGIDADKLVKELNEYFEKKE  67
CONSENSUS_1   21     EVFLKYGLDCCGCPIAGFETLEDACREHGIDLDELLEELNEAIAEKD  67
                     +++ + ++  +   +A+ E++++++RE G+ ++ L + L++  ++++
CONSENSUS_2   4      PKLTPEQIAEARRLLAAGESVAEIARELGVSRSTLYRYLPASEKRTA  50
d1hcra_       4      RAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSIKKR  50

All top COMPASS hits are HTH-containing proteins with different SCOP folds. Additionally, their E-values are quite low, so there is little doubt about evolutionary origin of T0473 and its homology to HTH domains. The 49-Gly-Ile-Asp-51 in T0473 is a very typical sequence for an HTH turn, and Ala44, four residues before Gly49, is a conserved small residue to make room for the second HTH helix packing. However only the HTH part of the domain is homologous, as the way it is completed is quite different among homologs:

2k53_1_ribbon
Ribbon diagram of T0473: 2k53 model 1
HTH is yellow-orange-red

1hcr_A_142_182
HIN recombinase DNA-binding domain: 1hcr chain A residues 142-182;
HTH is lime-yellow-orange-red

CASP category:

Comparative modeling: medium. Closest template detectable by HHpred, but contains some structural differences.

Closest templates:

The only full-length template was 2fi0, which is another structure of a hypothetical protein determined by a structural genomics center.

T0473    ----MKITKDMIIADVLQMDRGTAPIFINNGMHCLGCP-----SSMGESIEDACAVHGIDADKLVKELNEYFEKKEV--

2fi0_A   VVMDNIIDVSIPVAEVVDKHPEVLEILVELGFKPLANPLMRNTVGRKVSLKQGSKLAGTPMDKIVRTLEANGYEVIGLD

Both molecules are shown below with the most similar HTH region (yellow-red) at the back and more variable N-terminal helices in front. The first two helices (blue-cyan and cyan-green) have very similar orientations in both molecules, however, the differences are pronounced in the green-yellow region, where T0473 has a 6-residue deletion eliminating the fourth helix of 2fi0. Another interesting difference is that 2fi0 contains a C-terminal segment (red) that forms β-strand pairing with the N-terminial segment (blue). Thus a two-stranded β-sheet is present in 2fi0. However, T0473 lacks the C-terminal extension. Nevertheless, the N-terminal region (blue) still holds the extended conformation even without H-bond pairing, at least close to the first helix.

2k53 _1_1_67_ribbon
Ribbon diagram of T0473: 2k53 model 1 residues 1-67

2fi0_A:6-81
Ribbon diagram of 2fi0 chain A residues 6-81

Target sequence - PDB file inconsistencies:

NMR models contain two C-terminal residues 69-LE-70, not present in the target sequence (coming from His-tag).

T0473 2k53.pdb T0473.pdb PyMOL PyMOL of domains

T0473    1 MKITKDMIIADVLQMDRGTAPIFINNGMHCLGCPSSMGESIEDACAVHGIDADKLVKELNEYFEKKEV-- 68
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~
2k53A    1 MKITKDMIIADVLQMDRGTAPIFINNGMHCLGCPSSMGESIEDACAVHGIDADKLVKELNEYFEKKEVLE 70

Single domain protein: target 1-68 ; pdb 1-68

Sequence classification:

COG2846 in COG database, which is predicted to be "Regulator of cell morphogenesis and NO signaling". Below is PROMALS3D alignment of several most distant homologs detectable by PSI-BLAST. This alignment was not edited manually and may have errors.

Conservation:      9        5        7     6                      5                 7

T0473            ----MKITKDMIIADVLQMDRGTAPIFINNGMHCLGCP-----SSMGESIEDACAVHGIDADKLVKELNEYFEKKEV-------------------------------------

T0469         1  --MTQKFTKDMTFAQALQTHPGVAGVLRSYNLGCIGCM-----GAQNESLEQGANAHGLNVEDILRDLNALA------------------------------------------   65

2fi0_chainA   1  VVMDNIIDVSIPVAEVVDKHPEVLEILVELGFKPLANPLMRNTVGRKVSLKQGSKLAGTPMDKIVRTLEANGYEVIGLD-----------------------------------   79

gi_81428069   1  --MAKQIKLSQTVYELVTAYPEIVPILVSIGLDGVTNPALLNTAGRFMTLPKGAQMKQIPLSQIVATLTENDFEVIADD-----------------------------------   77

gi_109645979  1  --MA-LITKDMTVGQVLRSYPQTVQTFLELGMHCLGCPS-----STMESIEGAALTHGKKPDELVEKLNKVI----AAN-----------------------------------   67

gi_95930439   1  ----MLIQPQMTIKQIIDTWPQTLDVFTANGFEQFAQPEMIDRVGRFLKLESALSQKGYDCAAFIALLQERI----DAADQQADI-------TLVE------------------   81

gi_146300169  1  --M--ENLKNKTIGSFVAQDYRTAAVFSKYRIDF-CCK-------GNRTVDEVCEKQNIDADVLLQNIHEVI----QSENNGSIDFNSWPLDLLADYIEKTHHRYVEDKTHTLL   98

gi_163939963  1  --MKHTFTETSIIGEIVTQFPKASDLFKSYRIDF-CCG-------GNRPLIDAINERNLSATEVITELNTLY-NNTKLLNESEIDWKNASYRELIDYVINKHHR----------   93

Consensus_aa:    ..M..bhp.sbhl.phlpp@Pphh.lh.ph.hc..ts...........sl.pthp.pshshs.ll.pLp.............................................

Consensus_ss:                hhhhhhh   hhhhhhh                    hhhhhhhh   hhhhhhhhhhhh

Comments:

This protein is a close homolog of T0469:

T0473 --MKITKDMIIADVLQMDRGTAPIFINNGMHCLGCPSSMGESIEDACAVHGIDADKLVKELNEYFEKKEV

T0469 MTQKFTKDMTFAQALQTHPGVAGVLRSYNLGCIGCMGAQNESLEQGANAHGLNVEDILRDLNALA-----

Curiously, many sequences of this family contain conserved Cysteine residues in the most varible region of the molecule, and some also contain Histidine in the HTH turn. These residues are highlighted in magenta in the above family alignment and are shown on the structure of T0473. Due to their conservation, it was hypothesized that they might be part of a metal or some other ligand - binding site.

2k53_15 C,C,H
Ribbon diagram of T0473: 2k53 model 15,
Cys30, Cys33 and His48 are shown

Server predictions:

T0473:pdb 1-68:seq 1-68:CM_medium; alignment

distribution of
first scores
First models for T0473: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

#	GROUP ↓	TS ↓	TR ↓	CS ↓	TS ↓	TR ↓	CS ↓	TS ↓	TR ↓	CS ↓	TS ↓	TR ↓	CS ↓	↓ GROUP	#
		T0473			T0473			T0473			T0473
		First score			First Z-score			Best score			Best Z-score
1	mufold	81.25	77.33	80.82	1.32	1.73	1.57	82.72	79.78	80.82	1.42	1.89	1.41	mufold	1
2	KudlatyPredHuman	79.41	70.59	79.18	1.17	1.16	1.39	79.41	72.18	80.68	1.11	1.18	1.39	KudlatyPredHuman	2
3	METATASSER	79.41	69.61	77.58	1.17	1.08	1.21	79.41	71.32	77.58	1.11	1.09	1.03	METATASSER	3
4	MULTICOM	78.68	72.06	79.38	1.11	1.29	1.41	78.68	72.06	79.70	1.04	1.16	1.28	MULTICOM	4
5	DBAKER	78.68	69.36	80.46	1.11	1.06	1.53	78.68	69.36	80.46	1.04	0.91	1.37	DBAKER	5
6	Zhang−Server	77.57	69.73	78.26	1.02	1.09	1.28	79.04	71.94	78.81	1.08	1.15	1.17	Zhang−Server	6
7	GeneSilico	77.57	69.73	78.26	1.02	1.09	1.28	77.57	69.73	78.26	0.94	0.94	1.11	GeneSilico	7
8	McGuffin	77.57	69.73	78.26	1.02	1.09	1.28	82.35	79.41	78.60	1.39	1.86	1.15	McGuffin	8
9	FEIG	77.21	70.59	69.16	0.99	1.16	0.26	77.21	70.59	72.28	0.91	1.03	0.40	FEIG	9
10	Zhang	76.84	71.69	78.02	0.96	1.25	1.26	78.31	72.55	78.55	1.01	1.21	1.14	Zhang	10
11	TASSER	75.73	67.65	77.76	0.87	0.91	1.23	75.73	67.65	77.76	0.77	0.75	1.05	TASSER	11
12	AMU−Biology	74.63	70.47	69.44	0.78	1.15	0.29	75.37	70.47	74.49	0.74	1.01	0.66	AMU−Biology	12
13	Sternberg	73.90	66.54	74.01	0.72	0.82	0.80	73.90	66.54	74.01	0.60	0.64	0.60	Sternberg	13
14	Phyre_de_novo	73.90	66.54	74.02	0.72	0.82	0.81	73.90	66.54	74.05	0.60	0.64	0.61	Phyre_de_novo	14
15	SAM−T08−human	73.90	63.85	77.74	0.72	0.59	1.23	73.90	66.91	79.06	0.60	0.68	1.20	SAM−T08−human	15
16	StruPPi	73.16	65.81	69.98	0.66	0.75	0.35	73.16	65.81	69.98	0.53	0.57	0.12	StruPPi	16
17	3DShotMQ	73.16	65.56	75.94	0.66	0.73	1.02	73.16	65.56	75.94	0.53	0.55	0.83	3DShotMQ	17
18	Bates_BMM	73.16	59.19	76.31	0.66	0.19	1.06	79.41	74.27	79.86	1.11	1.37	1.30	Bates_BMM	18
19	3D−JIGSAW_V3	72.79	62.99	77.32	0.63	0.51	1.18	73.90	68.63	77.32	0.60	0.84	0.99	3D−JIGSAW_V3	19
20	IBT_LT	72.79	62.26	73.88	0.63	0.45	0.79	72.79	62.26	73.88	0.49	0.24	0.59	IBT_LT	20
21	LevittGroup	72.43	68.02	69.39	0.60	0.94	0.28	73.53	68.02	72.04	0.56	0.78	0.37	LevittGroup	21
22	BAKER−ROBETTA	72.43	60.91	72.27	0.60	0.34	0.61	74.27	65.93	75.62	0.63	0.58	0.79	BAKER−ROBETTA	22
23	GS−KudlatyPred	72.43	60.91	72.27	0.60	0.34	0.61	72.43	60.91	72.27	0.46	0.11	0.39	GS−KudlatyPred	23
24	Poing	72.06	65.44	71.92	0.57	0.72	0.57	72.06	65.44	71.92	0.43	0.54	0.35	Poing	24
25	FAMS−multi	72.06	64.71	71.42	0.57	0.66	0.51	72.43	64.71	71.66	0.46	0.47	0.32	FAMS−multi	25
26	MUSTER	72.06	64.71	69.36	0.57	0.66	0.28	72.06	64.71	69.36	0.43	0.47	0.05	MUSTER	26
27	SAM−T08−server	72.06	64.46	77.93	0.57	0.64	1.25	74.27	66.42	77.93	0.63	0.63	1.07	SAM−T08−server	27
28	BioSerf	72.06	58.82	70.80	0.57	0.16	0.44	72.06	58.82	70.80	0.43	-0.09	0.22	BioSerf	28
29	ACOMPMOD	72.06	56.37	72.56	0.57	-0.05	0.64	72.06	56.37	72.56	0.43	-0.32	0.43	ACOMPMOD	29
30	LEE	72.06	53.68	75.59	0.57	-0.28	0.98	72.79	62.38	75.59	0.49	0.25	0.79	LEE	30
31	3D−JIGSAW_AEP	71.69	68.50	70.36	0.54	0.98	0.39	73.16	69.00	72.54	0.53	0.87	0.43	3D−JIGSAW_AEP	31
32	NirBenTal	71.69	65.32	70.06	0.54	0.71	0.36	71.69	65.32	70.06	0.39	0.53	0.13	NirBenTal	32
33	fams−ace2	71.69	64.09	77.66	0.54	0.61	1.22	71.69	64.09	77.66	0.39	0.41	1.04	fams−ace2	33
34	pro−sp3−TASSER	71.69	63.85	72.92	0.54	0.59	0.68	82.35	79.41	77.66	1.39	1.86	1.04	pro−sp3−TASSER	34
35	EB_AMU_Physics	71.69	62.62	71.97	0.54	0.48	0.57	71.69	62.62	71.97	0.39	0.27	0.36	EB_AMU_Physics	35
36	tripos_08	71.32	65.93	65.42	0.51	0.76	-0.17	71.32	65.93	65.42	0.36	0.58	-0.42	tripos_08	36
37	Phragment	71.32	65.20	71.09	0.51	0.70	0.47	71.32	65.20	71.09	0.36	0.52	0.25	Phragment	37
38	Zico	71.32	64.71	72.80	0.51	0.66	0.67	77.57	69.48	78.68	0.94	0.92	1.16	Zico	38
39	ZicoFullSTP	71.32	64.71	72.80	0.51	0.66	0.67	77.57	69.48	78.68	0.94	0.92	1.16	ZicoFullSTP	39
40	ZicoFullSTPFullData	71.32	64.71	72.80	0.51	0.66	0.67	72.79	64.71	78.68	0.49	0.47	1.16	ZicoFullSTPFullData	40
41	keasar−server	71.32	62.74	70.65	0.51	0.49	0.42	72.43	63.85	72.36	0.46	0.39	0.41	keasar−server	41
42	Phyre2	70.96	63.36	71.61	0.48	0.55	0.53	70.96	63.36	71.61	0.32	0.34	0.32	Phyre2	42
43	Hao_Kihara	70.96	63.11	69.42	0.48	0.53	0.29	70.96	63.11	69.42	0.32	0.32	0.06	Hao_Kihara	43
44	MidwayFolding	70.96	63.11	71.78	0.48	0.53	0.55	70.96	63.11	71.78	0.32	0.32	0.34	MidwayFolding	44
45	RAPTOR	70.96	63.11	71.78	0.48	0.53	0.55	71.69	63.11	72.68	0.39	0.32	0.44	RAPTOR	45
46	PS2−server	70.96	62.38	70.21	0.48	0.46	0.37	70.96	62.38	70.21	0.32	0.25	0.15	PS2−server	46
47	PS2−manual	70.96	62.38	70.21	0.48	0.46	0.37	70.96	62.38	70.21	0.32	0.25	0.15	PS2−manual	47
48	Bilab−UT	70.96	60.66	71.84	0.48	0.32	0.56	72.43	62.74	71.84	0.46	0.28	0.34	Bilab−UT	48
49	Kolinski	70.59	62.01	74.00	0.45	0.43	0.80	70.96	63.36	75.08	0.32	0.34	0.73	Kolinski	49
50	COMA−M	70.59	61.52	68.61	0.45	0.39	0.19	70.59	61.52	68.61	0.29	0.17	-0.04	COMA−M	50
51	COMA	70.59	61.52	68.61	0.45	0.39	0.19	70.59	61.52	68.61	0.29	0.17	-0.04	COMA	51
52	Jones−UCL	70.59	60.29	70.32	0.45	0.29	0.39	70.59	60.29	70.32	0.29	0.05	0.16	Jones−UCL	52
53	nFOLD3	70.59	59.80	67.93	0.45	0.24	0.12	70.96	64.22	68.06	0.32	0.42	-0.11	nFOLD3	53
54	A−TASSER	70.59	58.33	71.15	0.45	0.12	0.48	78.68	75.49	76.00	1.04	1.49	0.84	A−TASSER	54
55	fleil	70.22	63.85	68.85	0.42	0.59	0.22	72.06	64.46	71.52	0.43	0.45	0.31	fleil	55
56	Chicken_George	70.22	63.36	72.51	0.42	0.55	0.63	74.63	63.36	78.65	0.67	0.34	1.15	Chicken_George	56
57	MUProt	70.22	61.89	70.31	0.42	0.42	0.39	70.59	61.89	70.52	0.29	0.20	0.19	MUProt	57
58	MULTICOM−CMFR	70.22	61.64	70.13	0.42	0.40	0.37	72.43	65.56	71.51	0.46	0.55	0.30	MULTICOM−CMFR	58
59	3DShot2	70.22	61.40	68.45	0.42	0.38	0.18	70.22	61.40	68.45	0.25	0.16	-0.06	3DShot2	59
60	HHpred4	70.22	61.15	70.24	0.42	0.36	0.38	70.22	61.15	70.24	0.25	0.13	0.15	HHpred4	60
61	HHpred5	70.22	61.15	70.24	0.42	0.36	0.38	70.22	61.15	70.24	0.25	0.13	0.15	HHpred5	61
62	MULTICOM−REFINE	70.22	60.66	70.05	0.42	0.32	0.36	70.22	61.89	70.48	0.25	0.20	0.18	MULTICOM−REFINE	62
63	MULTICOM−RANK	70.22	60.42	70.17	0.42	0.30	0.37	72.06	63.97	70.66	0.43	0.40	0.20	MULTICOM−RANK	63
64	3DShot1	69.85	61.52	72.64	0.39	0.39	0.65	69.85	61.52	72.64	0.22	0.17	0.44	3DShot1	64
65	MULTICOM−CLUSTER	69.85	61.03	70.26	0.39	0.35	0.38	71.32	63.97	70.26	0.36	0.40	0.16	MULTICOM−CLUSTER	65
66	PRI−Yang−KiharA	69.85	58.58	70.15	0.39	0.14	0.37	69.85	58.58	70.15	0.22	-0.11	0.14	PRI−Yang−KiharA	66
67	FAMSD	69.85	54.90	69.30	0.39	-0.17	0.27	69.85	62.38	69.30	0.22	0.25	0.04	FAMSD	67
68	SAM−T06−server	69.48	61.89	72.26	0.36	0.42	0.61	69.48	62.74	72.26	0.19	0.28	0.39	SAM−T06−server	68
69	pipe_int	69.48	60.66	66.88	0.36	0.32	-0.00	69.48	60.66	66.88	0.19	0.09	-0.25	pipe_int	69
70	Elofsson	69.48	60.66	70.29	0.36	0.32	0.38	70.22	60.91	70.32	0.25	0.11	0.16	Elofsson	70
71	HHpred2	69.48	60.66	69.66	0.36	0.32	0.31	69.48	60.66	69.66	0.19	0.09	0.08	HHpred2	71
72	SHORTLE	69.48	54.53	75.43	0.36	-0.20	0.96	69.48	54.53	75.43	0.19	-0.49	0.77	SHORTLE	72
73	FFASstandard	69.12	62.50	67.72	0.33	0.47	0.09	69.12	63.97	67.72	0.15	0.40	-0.15	FFASstandard	73
74	FUGUE_KM	68.75	62.62	66.70	0.30	0.48	-0.02	68.75	62.62	66.70	0.12	0.27	-0.27	FUGUE_KM	74
75	ABIpro	68.75	60.17	67.42	0.30	0.28	0.06	76.47	71.08	77.58	0.84	1.07	1.03	ABIpro	75
76	FFASsuboptimal	68.38	54.90	67.66	0.27	-0.17	0.09	71.69	62.62	70.62	0.39	0.27	0.20	FFASsuboptimal	76
77	TJ_Jiang	68.02	59.44	67.37	0.24	0.21	0.05	69.12	60.17	70.52	0.15	0.04	0.19	TJ_Jiang	77
78	FOLDpro	68.02	59.19	68.23	0.24	0.19	0.15	68.02	59.19	68.23	0.05	-0.05	-0.09	FOLDpro	78
79	mGenTHREADER	68.02	56.01	66.22	0.24	-0.08	-0.08	68.02	56.01	66.22	0.05	-0.35	-0.32	mGenTHREADER	79
80	FFASflextemplate	67.65	63.97	65.52	0.21	0.60	-0.15	69.12	63.97	67.72	0.15	0.40	-0.15	FFASflextemplate	80
81	GS−MetaServer2	67.65	60.54	68.93	0.21	0.31	0.23	69.48	60.54	70.21	0.19	0.07	0.15	GS−MetaServer2	81
82	PSI	67.28	62.87	64.88	0.18	0.50	-0.23	67.28	62.87	64.88	-0.02	0.30	-0.48	PSI	82
83	LOOPP_Server	67.28	60.66	61.60	0.18	0.32	-0.60	67.28	60.66	61.60	-0.02	0.09	-0.87	LOOPP_Server	83
84	CpHModels	66.91	62.99	64.96	0.15	0.51	-0.22	66.91	62.99	64.96	-0.05	0.31	-0.47	CpHModels	84
85	Pcons_local	66.91	62.50	64.96	0.15	0.47	-0.22	69.48	62.74	70.01	0.19	0.28	0.13	Pcons_local	85
86	Pcons_dot_net	66.91	62.50	64.96	0.15	0.47	-0.22	69.85	62.74	70.27	0.22	0.28	0.16	Pcons_dot_net	86
87	Pcons_multi	66.91	62.50	64.96	0.15	0.47	-0.22	69.85	62.99	68.76	0.22	0.31	-0.02	Pcons_multi	87
88	Softberry	66.91	57.11	65.25	0.15	0.01	-0.19	66.91	57.11	65.25	-0.05	-0.25	-0.44	Softberry	88
89	GeneSilicoMetaServer	66.54	59.68	66.71	0.12	0.23	-0.02	69.48	60.54	70.21	0.19	0.07	0.15	GeneSilicoMetaServer	89
90	xianmingpan	65.81	57.48	63.00	0.06	0.05	-0.44	65.81	57.48	63.00	-0.16	-0.21	-0.71	xianmingpan	90
91	SAM−T02−server	65.81	57.23	63.94	0.06	0.03	-0.33	65.81	57.23	63.94	-0.16	-0.24	-0.59	SAM−T02−server	91
92	SMEG−CCP	65.81	55.27	63.87	0.06	-0.14	-0.34	65.81	55.27	63.87	-0.16	-0.42	-0.60	SMEG−CCP	92
93	JIVE08	65.07	53.31	63.52	0.00	-0.31	-0.38	65.07	55.15	63.52	-0.23	-0.43	-0.64	JIVE08	93
94	FLOUDAS	57.72	43.51	54.58	-0.59	-1.14	-1.39	57.72	43.51	54.58	-0.91	-1.54	-1.71	FLOUDAS	94
95	Handl−Lovell	55.52	43.75	59.83	-0.77	-1.12	-0.80	58.09	49.02	63.69	-0.88	-1.01	-0.62	Handl−Lovell	95
96	Sasaki−Cetin−Sasai	54.04	49.39	60.14	-0.89	-0.64	-0.76	54.04	49.39	60.14	-1.26	-0.98	-1.05	Sasaki−Cetin−Sasai	96
97	SAINT1	51.84	41.79	59.92	-1.07	-1.29	-0.79	51.84	41.79	59.92	-1.46	-1.70	-1.07	SAINT1	97
98	FALCON_CONSENSUS	49.27	40.20	49.27	-1.28	-1.42	-1.99	50.73	40.20	49.27	-1.56	-1.85	-2.34	FALCON_CONSENSUS	98
99	FALCON	48.90	43.75	58.60	-1.31	-1.12	-0.94	49.27	43.75	58.60	-1.70	-1.51	-1.23	FALCON	99
100	keasar	44.12	42.28	56.43	-1.70	-1.25	-1.18	73.90	63.85	77.31	0.60	0.39	0.99	keasar	100
101	fais@hgc	43.75	37.87	58.01	-1.73	-1.62	-1.00	54.04	44.12	60.88	-1.26	-1.48	-0.96	fais@hgc	101
102	RBO−Proteus	43.38	41.79	55.89	-1.76	-1.29	-1.24	43.38	41.79	58.06	-2.25	-1.70	-1.29	RBO−Proteus	102
103	MUFOLD−MD	40.44	34.31	50.33	-1.99	-1.92	-1.87	50.00	40.32	55.44	-1.63	-1.84	-1.60	MUFOLD−MD	103
104	POEMQA	40.44	33.09	57.14	-1.99	-2.03	-1.10	75.73	66.05	80.58	0.77	0.60	1.38	POEMQA	104
105	forecast	40.07	29.53	52.46	-2.02	-2.33	-1.63	40.81	33.46	52.46	-2.49	-2.49	-1.96	forecast	105
106	PHAISTOS	39.71	36.77	51.55	-2.05	-1.71	-1.73	58.09	48.77	56.23	-0.88	-1.04	-1.51	PHAISTOS	106
107	Jiang_Zhu	39.34	34.93	49.85	-2.08	-1.87	-1.92	39.34	36.64	49.85	-2.63	-2.18	-2.27	Jiang_Zhu	107
108	fais−server	39.34	33.21	56.36	-2.08	-2.02	-1.19	49.27	46.57	57.24	-1.70	-1.25	-1.39	fais−server	108
109	circle	38.60	34.44	45.35	-2.14	-1.91	-2.43	71.69	63.85	68.95	0.39	0.39	0.00	circle	109
110	dill_ucsf	38.60	32.97	43.69	-2.14	-2.04	-2.62	38.60	32.97	43.69	-2.70	-2.53	-3.00	dill_ucsf	110
111	Frankenstein	38.60	31.00	48.10	-2.14	-2.21	-2.12	45.59	36.89	48.10	-2.04	-2.16	-2.48	Frankenstein	111
112	FrankensteinLong	38.60	31.00	48.10	-2.14	-2.21	-2.12	45.59	36.89	48.10	-2.04	-2.16	-2.48	FrankensteinLong	112
113	RPFM	38.60	28.43	42.15	-2.14	-2.42	-2.79	38.60	33.46	48.62	-2.70	-2.49	-2.42	RPFM	113
114	Wolynes	38.23	30.15	46.72	-2.17	-2.28	-2.28	42.65	37.87	46.90	-2.32	-2.07	-2.62	Wolynes	114
115	DistillSN	37.87	26.59	33.40	-2.20	-2.58	-3.78	41.91	36.52	38.31	-2.39	-2.20	-3.64	DistillSN	115
116	MeilerLabRene	37.50	37.01	54.90	-2.23	-1.69	-1.35	40.44	37.26	57.75	-2.52	-2.13	-1.33	MeilerLabRene	116
117	Distill	36.40	30.02	49.70	-2.32	-2.29	-1.94	40.44	32.11	51.08	-2.52	-2.61	-2.12	Distill	117
118	Scheraga	35.66	26.59	29.87	-2.38	-2.58	-4.18	36.40	31.98	37.28	-2.90	-2.63	-3.76	Scheraga	118
119	igor	34.93	31.00	37.45	-2.44	-2.21	-3.32	34.93	31.00	37.45	-3.04	-2.72	-3.74	igor	119
120	ShakAbInitio	34.19	26.59	44.72	-2.50	-2.58	-2.50	38.23	29.17	44.72	-2.73	-2.89	-2.88	ShakAbInitio	120
121	mariner1	34.19	24.63	27.53	-2.50	-2.75	-4.44	39.34	30.39	48.59	-2.63	-2.78	-2.42	mariner1	121
122	POEM	33.82	25.49	50.69	-2.53	-2.67	-1.83	43.75	40.44	80.58	-2.22	-1.83	1.38	POEM	122
123	MUFOLD−Server	33.09	26.72	43.02	-2.59	-2.57	-2.69	39.34	33.21	48.72	-2.63	-2.51	-2.40	MUFOLD−Server	123
124	rehtnap	31.98	29.78	32.60	-2.68	-2.31	-3.87	31.98	29.78	32.60	-3.31	-2.83	-4.32	rehtnap	124
125	schenk−torda−server	31.62	25.25	31.01	-2.71	-2.69	-4.05	33.82	27.45	32.21	-3.14	-3.05	-4.37	schenk−torda−server	125
126	RANDOM	29.00	23.84	29.00	-2.92	-2.81	-4.28	29.00	23.84	29.00	-3.59	-3.39	-4.75	RANDOM	126
127	Linnolt−UH−CMB	26.47	22.30	33.97	-3.13	-2.95	-3.72	26.47	22.30	33.97	-3.83	-3.54	-4.16	Linnolt−UH−CMB	127
128	panther_server	26.10	24.39	13.56	-3.16	-2.77	-6.02	26.10	24.39	13.56	-3.86	-3.34	-6.58	panther_server	128
129	mahmood−torda−server	25.00	21.20	38.90	-3.25	-3.04	-3.16	29.04	26.23	38.90	-3.59	-3.17	-3.57	mahmood−torda−server	129
130	Pushchino	23.90	21.69	7.77	-3.34	-3.00	-6.67	23.90	21.69	7.77	-4.07	-3.60	-7.27	Pushchino	130
131	TWPPLAB	22.79	19.61	8.14	-3.43	-3.17	-6.63	22.79	19.61	8.14	-4.17	-3.79	-7.23	TWPPLAB	131
132	DelCLab	22.43	19.73	8.17	-3.46	-3.16	-6.63	23.90	20.59	15.25	-4.07	-3.70	-6.38	DelCLab	132
133	3Dpro				-2.92	-2.81	-4.28				-3.59	-3.39	-4.75	3Dpro	133
134	Abagyan				-2.92	-2.81	-4.28				-3.59	-3.39	-4.75	Abagyan	134
135	BHAGEERATH				-2.92	-2.81	-4.28				-3.59	-3.39	-4.75	BHAGEERATH	135
136	CBSU				-2.92	-2.81	-4.28				-3.59	-3.39	-4.75	CBSU	136
137	FEIG_REFINE				-2.92	-2.81	-4.28				-3.59	-3.39	-4.75	FEIG_REFINE	137
138	Fiser−M4T				-2.92	-2.81	-4.28				-3.59	-3.39	-4.75	Fiser−M4T	138
139	HCA				-2.92	-2.81	-4.28				-3.59	-3.39	-4.75	HCA	139
140	LEE−SERVER				-2.92	-2.81	-4.28				-3.59	-3.39	-4.75	LEE−SERVER	140
141	NIM2				-2.92	-2.81	-4.28				-3.59	-3.39	-4.75	NIM2	141
142	Nano_team				-2.92	-2.81	-4.28				-3.59	-3.39	-4.75	Nano_team	142
143	OLGAFS				-2.92	-2.81	-4.28				-3.59	-3.39	-4.75	OLGAFS	143
144	Ozkan−Shell				-2.92	-2.81	-4.28				-3.59	-3.39	-4.75	Ozkan−Shell	144
145	POISE				-2.92	-2.81	-4.28				-3.59	-3.39	-4.75	POISE	145
146	PZ−UAM				-2.92	-2.81	-4.28				-3.59	-3.39	-4.75	PZ−UAM	146
147	ProtAnG				-2.92	-2.81	-4.28				-3.59	-3.39	-4.75	ProtAnG	147
148	ProteinShop				-2.92	-2.81	-4.28				-3.59	-3.39	-4.75	ProteinShop	148
149	SAMUDRALA				-2.92	-2.81	-4.28				-3.59	-3.39	-4.75	SAMUDRALA	149
150	TsaiLab				-2.92	-2.81	-4.28				-3.59	-3.39	-4.75	TsaiLab	150
151	UCDavisGenome				-2.92	-2.81	-4.28				-3.59	-3.39	-4.75	UCDavisGenome	151
152	Wolfson−FOBIA				-2.92	-2.81	-4.28				-3.59	-3.39	-4.75	Wolfson−FOBIA	152
153	YASARA				-2.92	-2.81	-4.28				-3.59	-3.39	-4.75	YASARA	153
154	YASARARefine				-2.92	-2.81	-4.28				-3.59	-3.39	-4.75	YASARARefine	154
155	Zhou−SPARKS				-2.92	-2.81	-4.28				-3.59	-3.39	-4.75	Zhou−SPARKS	155
156	dill_ucsf_extended				-2.92	-2.81	-4.28				-3.59	-3.39	-4.75	dill_ucsf_extended	156
157	huber−torda−server				-2.92	-2.81	-4.28				-3.59	-3.39	-4.75	huber−torda−server	157
158	jacobson				-2.92	-2.81	-4.28				-3.59	-3.39	-4.75	jacobson	158
159	mti				-2.92	-2.81	-4.28				-3.59	-3.39	-4.75	mti	159
160	mumssp				-2.92	-2.81	-4.28				-3.59	-3.39	-4.75	mumssp	160
161	psiphifoldings				-2.92	-2.81	-4.28				-3.59	-3.39	-4.75	psiphifoldings	161
162	ricardo				-2.92	-2.81	-4.28				-3.59	-3.39	-4.75	ricardo	162
163	rivilo				-2.92	-2.81	-4.28				-3.59	-3.39	-4.75	rivilo	163
164	sessions				-2.92	-2.81	-4.28				-3.59	-3.39	-4.75	sessions	164
165	taylor				-2.92	-2.81	-4.28				-3.59	-3.39	-4.75	taylor	165
166	test_http_server_01				-2.92	-2.81	-4.28				-3.59	-3.39	-4.75	test_http_server_01	166

Targets
387	388	389	390
391	392	393	394
395	396	397	398
399	400	401	402
403	404	405	406
407	408	409	410
411	412	413	414
415	416	417	418
419	420	421	422
423	424	425	426
427	428	429	430
431	432	433	434
435	436	437	438
439	440	441	442
443	444	445	446
447	448	449	450
451	452	453	454
455	456	457	458
459	460	461	462
463	464	465	466
467	468	469	470
471	472	473	474
475	476	477	478
479	480	481	482
483	484	485	486
487	488	489	490
491	492	493	494
495	496	497	498
499	500	501	502
503	504	505	506
507	508	509	510
511	512	513	514