T0392

Targets
387 388 389 390
391 392 393 394
395 396 397 398
399 400 401 402
403 404 405 406
407 408 409 410
411 412 413 414
415 416 417 418
419 420 421 422
423 424 425 426
427 428 429 430
431 432 433 434
435 436 437 438
439 440 441 442
443 444 445 446
447 448 449 450
451 452 453 454
455 456 457 458
459 460 461 462
463 464 465 466
467 468 469 470
471 472 473 474
475 476 477 478
479 480 481 482
483 484 485 486
487 488 489 490
491 492 493 494
495 496 497 498
499 500 501 502
503 504 505 506
507 508 509 510
511 512 513 514

T0392

PDZ domain of Rhophilin-2 Homo sapiens

Target type: Server only

Target sequence:

>T0392 RHPN2A, Homo sapiens, 109 residues
MHHHHHHSSGVDLGTENLYFQSMPRSIRFTAEEGDLGFTLRGNAPVQVHFLDPYCSASVAGAREGDYIVSIQLVDCKWLTLSEVMKLLKSFGEDEIEMKVVSLLDEVTF

Structure:
Method: X-ray, res=1.82Å, R/Rfree=0.22/0.27
Determined by: SGC
PDB ID: 2vsv

392_2vsv:A,B
Ribbon diagram of 392: 2vsv chains A (white) and B (rainbow)

PyMOL of 2vsv

Domains:  PyMOL of domains

Single domain protein. However, 1-23 (target numbers, and -23-0 in PDB numbers) are introduced in cloning, protrude away from the domain in 3D structure (interact with another chain, see above) and can be deleted for domain evaluation.

392 domain evaluation plot
Correlation between GDT-TS scores for domain-based evlatuation (without N-terminal segment, y, vertical axis) and whole chain GDT-TS (x, horizontal axis).

Each point represents first server model. Green, gray and black points are top 10, bottom 25% and the rest of prediction models. Blue line is the best-fit slope line (intersection 0) to the top 10 server models. Red line is the diagonal. Slope and root mean square y-x distance for the top 10 models (average difference between the domain GDT-TS scores and the whole chain GDT-TS score) are shown above the plot.

Structure classification:

PDZ domain fold.

2vsv_B:514-594 cartoon
Cartoon diagram of 392: 2vsv chain B residues 514-595

CASP category:

Whole chain: Comparative modeling:medium.

1st domain(with N-terminal segment seq:1-23 removed): Comparative modeling:easy.

Closest templates:

1vae

Target sequence - PDB file inconsistencies:

The most complete chain B is missing only the C-terminus 105-DEVTF-109. PDB numbering is different from the target. PDB coordinates are from -22 to 0 and from 514 to 594, which corresponds to the target 1 to 104.

T0392    2vsv.pdb    T0392.pdb    PyMOL    PyMOL of domains    

T0392    1 MHHHHHHSSGVDLGTENLYFQSMPRSIRFTAEEGDLGFTLRGNAPVQVHFLDPYCSASVAGAREGDYIVSIQLVDCKWLTLSEVMKLLKSFGEDEIEMKVVSLLDEVTF 109
           ~~~~~~~|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~
2vsvA  -15 -------SSGVDLGTENLYFQSMPRSIRFTAEEGDLGFTLRGNAPVQVHFLDPYCSASVAGAREGDYIVSIQLVDCKWLTLSEVMKLLKSFGEDEIEMKVVSLL----- 594

We suggest to evaluate this target as a single domain spanning whole chain. However, N-termial segment (target 1-23, pdb -15-0) is introduced in cloning, protrudes away from the domain in 3D structure (interact with another chain) and can be deleted for domain evaluation, resulting in this domain definition:

1st domain: target 24-104 ; pdb 514-594

Sequence classification:

PDZ signaling domain in CDD.

Server predictions:

T0392:pdb -15-594:seq 8-104:CM_medium;   alignment

distribution of first scores
First models for T0392: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

392_1:pdb 514-594:seq 24-104:CM_easy;   alignment

distribution of first scores
First models for T0392_1: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

# GROUP ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ ↓ GROUP #
T0392 392_1 T0392 392_1 T0392 392_1 T0392 392_1
First score First Z-score Best score Best Z-score
1 pro−sp3−TASSER 80.67 76.38 78.22 91.36 89.71 86.79 1.95 2.41 1.82 1.55 2.34 1.64 80.67 76.38 78.22 92.28 89.71 86.79 1.89 1.80 1.72 1.93 1.92 1.70 pro−sp3−TASSER 1
2 MULTICOM−RANK 80.41 79.72 76.57 92.28 91.46 85.86 1.87 3.28 1.42 1.81 2.68 1.41 80.41 79.72 76.57 92.28 91.46 85.86 1.79 2.70 1.25 1.93 2.31 1.39 MULTICOM−RANK 2
3 Zhang−Server 79.12 77.75 77.35 90.74 89.09 85.18 1.48 2.77 1.61 1.38 2.22 1.24 80.67 79.30 79.76 92.59 91.36 87.67 1.89 2.59 2.16 2.05 2.29 1.99 Zhang−Server 3
4 MULTICOM−CMFR 78.09 69.16 74.78 87.35 76.65 81.27 1.16 0.55 0.97 0.44 -0.21 0.27 78.09 69.16 74.78 87.35 81.28 81.27 0.95 -0.16 0.74 0.05 0.07 -0.11 MULTICOM−CMFR 4
5 FFASsuboptimal 78.09 68.73 73.60 87.35 76.03 81.23 1.16 0.44 0.68 0.44 -0.33 0.26 78.09 68.73 74.43 87.96 77.47 81.43 0.95 -0.28 0.65 0.28 -0.77 -0.05 FFASsuboptimal 5
6 Phyre_de_novo 78.09 68.47 75.76 87.96 76.85 82.73 1.16 0.37 1.22 0.61 -0.17 0.64 78.09 71.56 75.76 87.96 82.51 82.73 0.95 0.49 1.02 0.28 0.34 0.37 Phyre_de_novo 6
7 FEIG 77.83 66.84 72.96 87.35 75.82 81.67 1.08 -0.05 0.53 0.44 -0.37 0.37 77.83 72.42 72.96 87.65 79.32 81.67 0.86 0.72 0.23 0.16 -0.36 0.02 FEIG 7
8 BAKER−ROBETTA 77.58 68.21 73.94 87.96 76.65 81.43 1.01 0.30 0.77 0.61 -0.21 0.31 78.87 76.63 74.77 89.20 87.14 82.48 1.23 1.87 0.74 0.75 1.36 0.29 BAKER−ROBETTA 8
9 FALCON 77.32 74.74 75.55 88.58 86.52 85.16 0.93 1.99 1.16 0.78 1.72 1.24 77.58 75.17 76.66 88.58 86.52 86.29 0.76 1.47 1.28 0.52 1.22 1.53 FALCON 9
10 3DShot2 77.06 73.97 71.84 88.27 84.57 81.10 0.85 1.79 0.25 0.69 1.34 0.23 77.06 73.97 71.84 88.27 84.57 81.10 0.58 1.14 -0.09 0.40 0.79 -0.16 3DShot2 10
11 nFOLD3 77.06 68.13 73.21 87.65 76.95 81.48 0.85 0.28 0.59 0.52 -0.15 0.33 77.58 75.00 73.30 88.89 86.42 82.53 0.76 1.42 0.32 0.64 1.20 0.30 nFOLD3 11
12 huber−torda−server 76.80 67.44 72.22 87.96 76.65 81.43 0.77 0.10 0.34 0.61 -0.21 0.31 76.80 67.44 72.22 87.96 80.25 81.43 0.48 -0.63 0.02 0.28 -0.16 -0.05 huber−torda−server 12
13 MUProt 76.55 69.33 74.23 87.04 84.16 82.37 0.69 0.59 0.84 0.35 1.26 0.55 76.55 73.37 74.23 88.27 85.80 82.89 0.39 0.98 0.59 0.40 1.06 0.42 MUProt 13
14 LEE−SERVER 76.55 68.30 74.89 87.65 77.78 82.14 0.69 0.33 1.00 0.52 0.01 0.49 77.32 69.42 75.15 87.96 78.50 82.31 0.67 -0.09 0.85 0.28 -0.54 0.23 LEE−SERVER 14
15 FAMSD 76.55 67.53 72.42 87.65 76.75 81.10 0.69 0.13 0.39 0.52 -0.19 0.23 76.55 69.24 72.42 87.65 81.38 81.10 0.39 -0.14 0.07 0.16 0.09 -0.16 FAMSD 15
16 Phyre2 76.55 67.18 72.80 87.96 76.65 81.43 0.69 0.04 0.49 0.61 -0.21 0.31 76.55 71.82 72.80 87.96 82.92 81.43 0.39 0.56 0.18 0.28 0.43 -0.05 Phyre2 16
17 circle 76.29 67.95 73.26 87.35 77.26 81.27 0.61 0.24 0.60 0.44 -0.09 0.27 76.55 69.33 73.30 87.35 79.94 81.27 0.39 -0.11 0.32 0.05 -0.23 -0.11 circle 17
18 3Dpro 76.29 67.35 73.45 87.65 76.95 81.32 0.61 0.08 0.65 0.52 -0.15 0.29 76.29 67.35 73.45 87.65 76.95 81.32 0.30 -0.65 0.37 0.16 -0.89 -0.09 3Dpro 18
19 Poing 76.29 66.92 72.84 87.96 76.65 81.43 0.61 -0.03 0.50 0.61 -0.21 0.31 76.29 71.65 72.84 87.96 82.92 81.43 0.30 0.52 0.19 0.28 0.43 -0.05 Poing 19
20 Phragment 76.29 66.92 72.83 87.96 76.65 81.43 0.61 -0.03 0.49 0.61 -0.21 0.31 76.29 71.65 72.83 87.96 82.92 81.43 0.30 0.52 0.19 0.28 0.43 -0.05 Phragment 20
21 SAM−T08−server 76.29 66.50 75.33 88.27 84.98 83.45 0.61 -0.14 1.11 0.69 1.42 0.81 76.29 71.82 75.33 88.27 85.08 83.45 0.30 0.56 0.90 0.40 0.90 0.61 SAM−T08−server 21
22 HHpred2 76.03 68.99 73.19 87.35 78.91 81.29 0.53 0.50 0.58 0.44 0.24 0.28 76.03 68.99 73.19 87.35 78.91 81.29 0.20 -0.21 0.29 0.05 -0.45 -0.10 HHpred2 22
23 mGenTHREADER 76.03 66.67 71.63 87.96 76.65 81.43 0.53 -0.10 0.20 0.61 -0.21 0.31 76.03 66.67 71.63 87.96 76.65 81.43 0.20 -0.83 -0.15 0.28 -0.95 -0.05 mGenTHREADER 23
24 MUSTER 76.03 65.98 73.45 87.35 75.21 81.30 0.53 -0.27 0.65 0.44 -0.49 0.28 77.58 71.73 74.00 89.51 82.92 82.60 0.76 0.54 0.52 0.87 0.43 0.33 MUSTER 24
25 PS2−server 76.03 61.94 72.55 87.65 70.78 81.37 0.53 -1.32 0.42 0.52 -1.35 0.30 76.03 73.02 72.55 87.65 82.41 81.37 0.20 0.89 0.11 0.16 0.32 -0.07 PS2−server 25
26 Pcons_local 75.77 68.90 70.45 88.89 84.36 82.86 0.45 0.48 -0.09 0.87 1.30 0.67 76.03 71.56 70.45 88.89 84.98 82.86 0.20 0.49 -0.49 0.64 0.88 0.41 Pcons_local 26
27 YASARA 75.77 68.90 76.37 88.27 80.04 84.97 0.45 0.48 1.37 0.69 0.46 1.19 75.77 68.90 76.37 88.27 80.04 84.97 0.11 -0.23 1.20 0.40 -0.21 1.10 YASARA 27
28 keasar−server 75.77 65.72 71.63 87.96 75.82 81.57 0.45 -0.34 0.20 0.61 -0.37 0.35 76.03 67.44 72.27 87.96 77.88 82.07 0.20 -0.63 0.03 0.28 -0.68 0.15 keasar−server 28
29 forecast 75.52 66.15 72.69 87.04 75.72 81.56 0.38 -0.23 0.46 0.35 -0.39 0.35 75.52 66.15 72.69 87.04 83.54 81.58 0.02 -0.98 0.15 -0.07 0.57 -0.01 forecast 29
30 PSI 75.52 65.89 73.07 86.73 75.21 81.09 0.38 -0.30 0.55 0.27 -0.49 0.23 76.29 72.34 73.07 88.89 84.36 81.85 0.30 0.70 0.26 0.64 0.75 0.08 PSI 30
31 MULTICOM−REFINE 75.26 71.48 73.09 88.27 83.95 83.32 0.30 1.15 0.56 0.69 1.22 0.78 76.55 72.25 74.08 88.27 83.95 83.32 0.39 0.68 0.55 0.40 0.66 0.56 MULTICOM−REFINE 31
32 Fiser−M4T 75.26 68.39 69.18 87.65 79.42 81.20 0.30 0.35 -0.41 0.52 0.33 0.26 75.26 68.39 69.18 87.65 79.42 81.20 -0.08 -0.37 -0.85 0.16 -0.34 -0.13 Fiser−M4T 32
33 ACOMPMOD 75.00 68.64 73.64 88.27 82.92 86.22 0.22 0.41 0.69 0.69 1.02 1.50 75.00 68.64 73.64 88.27 82.92 86.22 -0.17 -0.30 0.42 0.40 0.43 1.51 ACOMPMOD 33
34 OLGAFS 75.00 66.41 70.86 87.96 76.44 81.43 0.22 -0.16 0.01 0.61 -0.25 0.31 75.00 66.41 70.86 87.96 76.44 81.43 -0.17 -0.91 -0.37 0.28 -1.00 -0.05 OLGAFS 34
35 Pcons_dot_net 74.48 71.91 73.59 87.65 85.19 86.06 0.06 1.26 0.68 0.52 1.46 1.46 75.77 71.91 73.59 88.89 85.19 86.06 0.11 0.59 0.41 0.64 0.93 1.46 Pcons_dot_net 35
36 Pcons_multi 74.48 71.91 73.59 87.65 85.19 86.06 0.06 1.26 0.68 0.52 1.46 1.46 79.90 74.91 74.68 89.81 86.52 86.06 1.61 1.40 0.72 0.99 1.22 1.46 Pcons_multi 36
37 FUGUE_KM 74.48 71.73 72.27 87.96 85.70 84.96 0.06 1.21 0.36 0.61 1.56 1.19 74.48 71.73 72.27 87.96 85.70 84.96 -0.36 0.54 0.03 0.28 1.04 1.10 FUGUE_KM 37
38 FFASstandard 74.48 65.21 68.29 87.96 76.85 81.31 0.06 -0.47 -0.63 0.61 -0.17 0.28 74.48 65.21 71.44 87.96 76.85 81.43 -0.36 -1.23 -0.21 0.28 -0.91 -0.05 FFASstandard 38
39 FFASflextemplate 74.48 65.21 68.29 87.96 76.85 81.31 0.06 -0.47 -0.63 0.61 -0.17 0.28 74.48 65.21 68.36 87.96 76.85 81.43 -0.36 -1.23 -1.08 0.28 -0.91 -0.05 FFASflextemplate 39
40 GeneSilicoMetaServer 74.23 66.15 67.04 86.42 84.36 79.20 -0.02 -0.23 -0.93 0.18 1.30 -0.24 74.48 71.73 72.32 87.65 85.19 84.41 -0.36 0.54 0.04 0.16 0.93 0.92 GeneSilicoMetaServer 40
41 CpHModels 74.23 60.48 70.78 86.42 69.96 83.03 -0.02 -1.70 -0.01 0.18 -1.51 0.71 74.23 60.48 70.78 86.42 69.96 83.03 -0.45 -2.51 -0.39 -0.30 -2.42 0.47 CpHModels 41
42 MUFOLD−Server 73.97 69.33 73.33 86.42 81.28 80.74 -0.09 0.59 0.62 0.18 0.70 0.14 74.48 69.59 73.38 87.35 81.28 81.39 -0.36 -0.04 0.35 0.05 0.07 -0.07 MUFOLD−Server 42
43 RAPTOR 73.71 71.65 71.05 84.88 82.41 80.07 -0.17 1.19 0.05 -0.25 0.92 -0.02 78.09 73.28 76.65 88.89 84.77 85.48 0.95 0.96 1.28 0.64 0.84 1.27 RAPTOR 43
44 MULTICOM−CLUSTER 73.45 69.50 71.78 86.42 81.69 81.57 -0.25 0.64 0.23 0.18 0.78 0.35 77.32 73.11 75.49 87.96 83.75 82.60 0.67 0.91 0.95 0.28 0.61 0.33 MULTICOM−CLUSTER 44
45 COMA 73.45 68.47 68.08 86.42 80.66 80.01 -0.25 0.37 -0.68 0.18 0.58 -0.04 73.45 68.47 68.08 86.42 80.66 80.01 -0.73 -0.35 -1.16 -0.30 -0.07 -0.52 COMA 45
46 rehtnap 73.20 69.42 68.57 84.88 80.35 78.88 -0.33 0.61 -0.56 -0.25 0.52 -0.32 74.48 71.05 68.92 86.42 81.89 79.53 -0.36 0.35 -0.92 -0.30 0.20 -0.68 rehtnap 46
47 BioSerf 72.94 60.74 70.64 86.73 72.33 79.41 -0.41 -1.63 -0.05 0.27 -1.05 -0.19 72.94 60.74 70.64 86.73 72.33 79.41 -0.92 -2.44 -0.43 -0.19 -1.90 -0.72 BioSerf 47
48 fais−server 71.91 67.27 67.55 81.79 76.44 77.64 -0.72 0.06 -0.81 -1.11 -0.25 -0.62 76.03 67.27 72.07 87.65 77.26 81.41 0.20 -0.67 -0.03 0.16 -0.82 -0.06 fais−server 48
49 GS−KudlatyPred 71.65 65.12 63.56 80.25 73.05 71.21 -0.80 -0.50 -1.79 -1.54 -0.91 -2.21 71.65 65.12 63.56 80.25 73.05 71.21 -1.39 -1.26 -2.45 -2.65 -1.74 -3.40 GS−KudlatyPred 49
50 pipe_int 71.39 63.32 73.88 82.41 77.88 80.49 -0.88 -0.96 0.75 -0.94 0.03 0.08 77.58 72.25 78.00 87.96 84.88 84.53 0.76 0.68 1.66 0.28 0.86 0.96 pipe_int 50
51 Frankenstein 71.13 67.70 68.44 82.10 78.19 77.93 -0.96 0.17 -0.59 -1.02 0.09 -0.55 75.26 68.56 75.18 87.04 80.35 83.30 -0.08 -0.32 0.86 -0.07 -0.14 0.56 Frankenstein 51
52 SAM−T02−server 71.13 61.86 60.20 83.95 73.25 72.91 -0.96 -1.34 -2.62 -0.51 -0.87 -1.79 71.13 67.27 61.12 83.95 77.16 72.91 -1.58 -0.67 -3.15 -1.24 -0.84 -2.84 SAM−T02−server 52
53 mariner1 70.88 62.11 63.85 80.86 69.14 70.99 -1.04 -1.27 -1.72 -1.37 -1.67 -2.27 76.29 70.79 73.87 88.27 82.72 82.23 0.30 0.28 0.49 0.40 0.38 0.21 mariner1 53
54 METATASSER 70.62 63.57 69.99 80.56 73.35 78.53 -1.12 -0.90 -0.21 -1.45 -0.85 -0.40 77.06 71.05 75.31 89.51 82.92 84.38 0.58 0.35 0.90 0.87 0.43 0.91 METATASSER 54
55 Distill 70.36 57.82 61.22 82.72 67.69 72.04 -1.20 -2.38 -2.37 -0.85 -1.96 -2.01 70.62 63.92 64.15 83.03 70.68 75.02 -1.76 -1.58 -2.28 -1.60 -2.27 -2.15 Distill 55
56 GS−MetaServer2 70.10 63.23 61.29 78.70 71.09 70.41 -1.28 -0.98 -2.35 -1.97 -1.29 -2.41 73.97 67.70 68.73 87.65 81.07 80.71 -0.55 -0.56 -0.98 0.16 0.02 -0.29 GS−MetaServer2 56
57 panther_server 69.84 59.88 62.10 81.79 71.09 72.86 -1.36 -1.85 -2.15 -1.11 -1.29 -1.81 72.42 69.16 66.95 84.57 80.45 77.82 -1.11 -0.16 -1.49 -1.01 -0.12 -1.23 panther_server 57
58 SAM−T06−server 67.78 63.49 64.61 78.39 74.07 68.73 -1.98 -0.92 -1.53 -2.06 -0.71 -2.83 70.10 67.27 64.61 83.64 79.53 76.34 -1.95 -0.67 -2.15 -1.36 -0.32 -1.72 SAM−T06−server 58
59 HHpred4 66.75 63.66 63.07 78.09 71.30 73.19 -2.30 -0.87 -1.91 -2.14 -1.25 -1.72 66.75 63.66 63.07 78.09 71.30 73.19 -3.16 -1.65 -2.59 -3.48 -2.13 -2.75 HHpred4 59
60 HHpred5 66.75 63.66 63.07 78.09 71.30 73.19 -2.30 -0.87 -1.91 -2.14 -1.25 -1.72 66.75 63.66 63.07 78.09 71.30 73.19 -3.16 -1.65 -2.59 -3.48 -2.13 -2.75 HHpred5 60
61 3D−JIGSAW_V3 65.72 60.83 65.07 75.31 69.14 71.60 -2.61 -1.60 -1.42 -2.91 -1.67 -2.12 70.10 67.01 71.92 80.86 77.78 80.10 -1.95 -0.74 -0.07 -2.42 -0.70 -0.49 3D−JIGSAW_V3 61
62 COMA−M 65.46 59.97 64.34 76.23 69.24 73.85 -2.69 -1.83 -1.60 -2.66 -1.65 -1.56 72.68 68.73 67.51 84.26 80.56 77.55 -1.01 -0.28 -1.33 -1.13 -0.09 -1.32 COMA−M 62
63 3D−JIGSAW_AEP 64.69 60.22 69.59 75.31 69.96 76.29 -2.93 -1.76 -0.31 -2.91 -1.51 -0.96 65.98 60.48 69.59 75.93 69.96 76.57 -3.44 -2.51 -0.73 -4.30 -2.42 -1.64 3D−JIGSAW_AEP 63
64 FALCON_CONSENSUS 54.64 43.81 50.10 63.58 51.65 57.18 -5.99 -6.00 -5.11 -6.18 -5.09 -5.68 54.64 43.81 50.10 63.58 51.65 57.18 -7.56 -7.03 -6.28 -9.00 -6.45 -7.98 FALCON_CONSENSUS 64
65 MUFOLD−MD 48.97 42.95 47.22 58.64 51.44 55.64 -7.73 -6.23 -5.82 -7.55 -5.13 -6.06 48.97 42.95 47.22 58.64 51.44 55.64 -9.61 -7.27 -7.10 -10.89 -6.50 -8.49 MUFOLD−MD 65
66 FOLDpro 47.68 40.29 40.02 56.48 47.63 48.47 -8.12 -6.91 -7.60 -8.15 -5.87 -7.84 64.95 59.19 57.38 73.77 67.80 63.89 -3.82 -2.86 -4.21 -5.12 -2.90 -5.79 FOLDpro 66
67 RBO−Proteus 24.48 21.65 32.68 29.32 25.93 36.72 -15.20 -11.73 -9.41 -15.71 -10.11 -10.74 24.48 21.65 32.68 29.32 25.93 37.08 -18.50 -13.04 -11.24 -22.05 -12.12 -14.55 RBO−Proteus 67
68 mahmood−torda−server 21.91 15.38 28.43 23.46 17.49 28.98 -15.98 -13.35 -10.45 -17.34 -11.75 -12.66 21.91 17.27 28.43 23.46 18.42 28.98 -19.43 -14.23 -12.46 -24.29 -13.77 -17.20 mahmood−torda−server 68
69 RANDOM 18.64 15.40 18.64 22.31 18.03 22.31 -16.98 -13.34 -12.87 -17.66 -11.65 -14.31 18.64 15.40 18.64 22.31 18.03 22.31 -20.62 -14.74 -15.24 -24.72 -13.86 -19.38 RANDOM 69
70 schenk−torda−server 16.50 14.09 22.13 18.52 15.54 25.13 -17.64 -13.68 -12.01 -18.71 -12.14 -13.61 18.81 15.98 22.13 21.30 19.14 25.13 -20.56 -14.58 -14.25 -25.11 -13.61 -18.46 schenk−torda−server 70
71 BHAGEERATH                                     -16.98 -13.34 -12.87 -17.66 -11.65 -14.31                                     -20.62 -14.74 -15.24 -24.72 -13.86 -19.38 BHAGEERATH 71
72 LOOPP_Server                                     -16.98 -13.34 -12.87 -17.66 -11.65 -14.31                                     -20.62 -14.74 -15.24 -24.72 -13.86 -19.38 LOOPP_Server 72
73 Pushchino                                     -16.98 -13.34 -12.87 -17.66 -11.65 -14.31                                     -20.62 -14.74 -15.24 -24.72 -13.86 -19.38 Pushchino 73
74 test_http_server_01                                     -16.98 -13.34 -12.87 -17.66 -11.65 -14.31                                     -20.62 -14.74 -15.24 -24.72 -13.86 -19.38 test_http_server_01 74