T0483

Targets
387 388 389 390
391 392 393 394
395 396 397 398
399 400 401 402
403 404 405 406
407 408 409 410
411 412 413 414
415 416 417 418
419 420 421 422
423 424 425 426
427 428 429 430
431 432 433 434
435 436 437 438
439 440 441 442
443 444 445 446
447 448 449 450
451 452 453 454
455 456 457 458
459 460 461 462
463 464 465 466
467 468 469 470
471 472 473 474
475 476 477 478
479 480 481 482
483 484 485 486
487 488 489 490
491 492 493 494
495 496 497 498
499 500 501 502
503 504 505 506
507 508 509 510
511 512 513 514

T0483

PAS domain-containing serine/threonine-protein kinase from Homo sapiens

Target type: Server only

Target sequence:

>T0483 PAS kinase, Human, 335 residues
MALEEPPKAVELEGLAACEGEYSQKYSTMSPLGSGAFGFVWTAVDKEKNKEVVVKFIKKEKVLEDCWIEDPKLGKVTLEIAILSRVEHANIIKVLDIFENQGFFQLVMEKHGSGLDLFAFIDRHPRLDEPLASYIFRQLVSAVGYLRLKDIIHRDIKDENIVIAEDFTIKLIDFGSAAYLERGKLFYTFCGTIEYCAPEVLMGNPYRGPELEMWSLGVTLYTLVFEENPFCELEETVEAAIHPPYLVSKELMSLVSGLLQPVPERRTTLEKLVTDPWVTQPVNLADYTWEEVFRVNKPESGVLSAASLEMGNRSLSDVAQAQELCGGEGHHHHHH

Structure:
Method: X-ray, res=2.3Å, R/Rfree=0.24/0.30
Determined by: NYSGRC
PDB ID: 3dls

3dls_A cartoon
Cartoon diagram of 483: 3dls chain A

PyMOL of 3dls

Domains:  PyMOL of domains

Two domains. Residue ranges in PDB: 982-1083 and 1084-1266. Residue ranges in target: 9-110 and 111-293.

483 domain evaluation plot
Correlation between weighted by the number of residues sum of GDT-TS scores for domain-based evlatuation (y, vertical axis) and whole chain GDT-TS (x, horizontal axis).

To compute the weighted sum, GDT-TS for each domain was multiplied by the domain length, and this sum was divided by the sum of domain lengths. Each point represents first server model. Green, gray and black points are top 10, bottom 25% and the rest of prediction models. Blue line is the best-fit slope line (intersection 0) to the top 10 server models. Red line is the diagonal. Slope and root mean square y-x distance for the top 10 models (average difference between the weighted sum of domain GDT-TS scores and the whole chain GDT-TS score) are shown above the plot.

Structure classification:

Protein kinase two-domain fold.

CASP category:

Whole chain: Comparative modeling:medium.

1st domain: Comparative modeling:medium. 2nd domain: Comparative modeling:easy.

Closest templates:

1kob, 2rku, 1y8g, 1koa, 1o6l.

Target sequence - PDB file inconsistencies:

T0483    3dls.pdb    T0483.pdb    PyMOL    PyMOL of domains    

T0483    1 MALEEPPKAVELEGLAACEGEYSQKYSTMSPLGSGAFGFVWTAVDKEKNKEVVVKFIKKEKVLEDCWIEDPKLGKVTLEIAILSRVEHANIIKVLDIFENQGFFQLVMEKHGSGLDLFAFIDRHPRLDEPLASYIFRQLVSAVGYLRLKDIIHRDIKDENIVIAEDFTIKLIDFGSAAYLERGKLFYTFCGTIEYCAPEVLMGNPYRGPELEMWSLGVTLYTLVFEENPFCELEETVEAAIHPPYLVSKELMSLVSGLLQPVPERRTTLEKLVTDPWVTQPVNLADYTWEEVFRVNKPESGVLSAASLEMGNRSLSDVAQAQELCGGEGHHHHHH 335
           ~~~~~~~~|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
3dlsA  982 --------AVELEGLAACEGEYSQKYSTMSPLGSGAFGFVWTAVDKEKNKEVVVKFIKKEKVLEDCWIEDPKLGKVTLEIAILSRVEHANIIKVLDIFENQGFFQLVMEKHGSGLDLFAFIDRHPRLDEPLASYIFRQLVSAVGYLRLKDIIHRDIKDENIVIAEDFTIKLIDFGSAAYLERGKLFYTFCGTIEYCAPEVLMGNPYRGPELEMWSLGVTLYTLVFEENPFCELEETVEAAIHPPYLVSKELMSLVSGLLQPVPERRTTLEKLVTDPWVTQPVNLADYTWEEVF------------------------------------------ 1266

We suggest to evaluate this target as a single domain spanning whole chain. However, evolutionarily this is a 2-domain protein:

1st domain: target 9-110 ; pdb 982-1083

2nd domain: target 111-293 ; pdb 1084-1266

Sequence classification:

S_TKc superfamily in CDD.

Server predictions:

T0483:pdb 982-1266:seq 9-293:CM_medium;   alignment

distribution of first scores
First models for T0483: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

483_1:pdb 982-1083:seq 9-110:CM_medium;   alignment

distribution of first scores
First models for T0483_1: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

483_2:pdb 1084-1266:seq 111-293:CM_easy;   alignment

distribution of first scores
First models for T0483_2: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

# GROUP ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ ↓ GROUP #
T0483 483_1 483_2 T0483 483_1 483_2 T0483 483_1 483_2 T0483 483_1 483_2
First score First Z-score Best score Best Z-score
1 LEE−SERVER 74.30 67.16 79.35 66.67 62.42 72.70 83.74 81.74 84.83 1.88 1.47 1.66 0.97 1.28 1.59 1.84 2.03 1.48 74.30 70.70 79.35 66.67 62.42 72.70 84.15 82.33 84.87 1.70 1.88 1.62 0.67 0.95 1.58 1.89 2.03 1.39 LEE−SERVER 1
2 MULTICOM−REFINE 73.95 66.11 76.80 64.95 61.52 67.57 83.20 81.74 83.93 1.81 1.29 1.24 0.46 1.06 0.41 1.74 2.03 1.35 75.09 69.94 76.80 65.69 61.60 67.57 83.47 82.01 83.94 1.88 1.73 1.11 0.31 0.69 -0.03 1.74 1.97 1.23 MULTICOM−REFINE 2
3 MULTICOM−RANK 73.86 70.64 76.48 64.71 61.11 67.31 83.06 81.60 83.68 1.79 2.04 1.19 0.39 0.96 0.35 1.72 2.01 1.32 73.95 70.64 76.77 66.67 61.52 68.21 83.06 81.60 84.00 1.63 1.87 1.10 0.67 0.67 0.18 1.64 1.90 1.24 MULTICOM−RANK 3
4 MULTICOM−CMFR 73.77 66.75 76.36 65.20 61.27 67.05 82.92 80.92 83.61 1.78 1.40 1.17 0.54 1.00 0.29 1.69 1.90 1.31 73.77 66.75 76.36 65.20 61.27 67.39 82.92 80.92 83.61 1.59 1.11 1.02 0.13 0.59 -0.08 1.61 1.77 1.17 MULTICOM−CMFR 4
5 MULTICOM−CLUSTER 72.89 70.09 77.08 64.22 59.31 68.25 83.20 81.74 84.07 1.60 1.95 1.29 0.25 0.52 0.56 1.74 2.03 1.37 73.95 70.09 77.54 69.61 61.52 70.11 83.20 81.74 84.21 1.63 1.76 1.25 1.76 0.67 0.77 1.68 1.92 1.28 MULTICOM−CLUSTER 5
6 LOOPP_Server 72.63 65.56 75.18 69.36 64.79 63.84 81.83 77.55 84.15 1.55 1.20 0.97 1.77 1.86 -0.45 1.50 1.39 1.39 72.63 65.56 77.92 72.79 64.79 71.20 81.83 77.55 84.15 1.34 0.88 1.33 2.94 1.71 1.11 1.37 1.15 1.27 LOOPP_Server 6
7 FALCON 72.46 66.49 74.96 65.20 62.42 69.06 78.69 70.58 80.47 1.52 1.35 0.93 0.54 1.28 0.75 0.94 0.32 0.88 72.46 67.43 74.96 65.93 63.48 69.06 78.69 72.68 80.47 1.30 1.25 0.73 0.40 1.29 0.44 0.67 0.25 0.63 FALCON 7
8 MUProt 72.37 68.63 75.74 63.23 59.48 65.72 82.65 80.56 83.25 1.50 1.71 1.06 -0.04 0.56 -0.02 1.64 1.85 1.26 73.95 68.63 76.93 64.71 61.36 67.52 83.61 82.15 84.25 1.63 1.48 1.13 -0.05 0.62 -0.04 1.77 2.00 1.28 MUProt 8
9 nFOLD3 71.49 67.81 78.51 72.06 68.79 73.40 80.33 77.14 84.03 1.33 1.57 1.52 2.56 2.84 1.75 1.23 1.33 1.37 72.72 69.21 78.51 72.06 68.79 73.40 80.46 78.28 84.03 1.36 1.59 1.45 2.67 2.98 1.80 1.07 1.29 1.25 nFOLD3 9
10 FALCON_CONSENSUS 71.40 66.14 73.92 63.48 60.87 66.17 77.32 72.68 80.45 1.31 1.30 0.76 0.03 0.90 0.08 0.70 0.65 0.87 72.46 67.43 74.96 65.93 63.48 69.06 78.69 72.68 80.47 1.30 1.25 0.73 0.40 1.29 0.44 0.67 0.25 0.63 FALCON_CONSENSUS 10
11 Zhang−Server 70.17 64.03 78.01 70.10 64.46 71.41 80.60 75.50 83.70 1.07 0.95 1.44 1.98 1.78 1.29 1.28 1.08 1.32 70.79 67.22 78.88 70.34 65.44 71.41 81.69 79.33 85.67 0.93 1.21 1.52 2.03 1.91 1.18 1.34 1.48 1.53 Zhang−Server 11
12 FAMSD 69.74 62.95 73.32 66.91 57.60 67.96 78.69 71.86 80.45 0.99 0.77 0.66 1.04 0.10 0.50 0.94 0.52 0.87 69.74 62.95 73.32 66.91 58.17 67.96 78.69 71.86 80.45 0.70 0.38 0.40 0.76 -0.40 0.10 0.67 0.10 0.62 FAMSD 12
13 rehtnap 68.95 63.57 69.24 64.46 57.11 64.57 75.82 72.36 76.58 0.83 0.87 -0.02 0.32 -0.02 -0.29 0.43 0.60 0.34 68.95 63.57 69.24 64.46 57.11 64.57 76.37 73.09 76.74 0.53 0.50 -0.42 -0.15 -0.74 -0.96 0.15 0.33 -0.02 rehtnap 13
14 GS−KudlatyPred 68.86 65.64 73.58 63.97 61.19 67.60 76.09 72.91 79.54 0.82 1.21 0.71 0.18 0.98 0.41 0.48 0.68 0.75 68.86 65.64 73.58 63.97 61.19 67.60 76.09 72.91 79.54 0.51 0.90 0.46 -0.33 0.56 -0.02 0.09 0.29 0.47 GS−KudlatyPred 14
15 HHpred2 68.77 60.59 74.74 64.22 57.84 70.22 76.50 74.41 78.74 0.80 0.37 0.90 0.25 0.16 1.02 0.55 0.91 0.64 68.77 60.59 74.74 64.22 57.84 70.22 76.50 74.41 78.74 0.49 -0.08 0.69 -0.24 -0.50 0.80 0.18 0.57 0.33 HHpred2 15
16 Fiser−M4T 68.25 64.39 73.60 61.52 54.90 63.62 78.42 75.50 80.60 0.70 1.01 0.71 -0.55 -0.56 -0.51 0.89 1.08 0.90 68.25 64.39 73.60 61.52 54.90 63.62 78.42 75.50 80.60 0.37 0.66 0.46 -1.24 -1.44 -1.26 0.61 0.77 0.65 Fiser−M4T 16
17 circle 67.89 63.22 69.96 65.69 63.07 63.20 75.27 72.54 75.68 0.63 0.81 0.10 0.68 1.44 -0.60 0.33 0.62 0.22 69.91 66.46 72.08 67.40 64.79 68.85 79.78 75.50 80.14 0.74 1.06 0.15 0.94 1.71 0.38 0.91 0.77 0.57 circle 17
18 3Dpro 67.81 64.12 69.39 60.54 53.19 63.67 74.73 70.63 73.66 0.61 0.96 0.01 -0.84 -0.98 -0.49 0.23 0.33 -0.06 67.81 64.12 69.39 60.54 56.78 63.67 74.73 70.63 73.66 0.28 0.60 -0.39 -1.60 -0.84 -1.24 -0.21 -0.13 -0.55 3Dpro 18
19 pro−sp3−TASSER 67.72 61.11 77.35 66.91 61.85 70.05 79.23 72.40 84.15 0.59 0.46 1.33 1.04 1.14 0.98 1.04 0.60 1.39 69.12 62.16 77.35 66.91 63.89 70.55 79.23 75.55 84.15 0.57 0.22 1.22 0.76 1.42 0.91 0.79 0.78 1.27 pro−sp3−TASSER 19
20 3DShot2 67.63 59.97 71.14 59.56 46.00 58.95 78.55 69.99 81.04 0.58 0.27 0.30 -1.13 -2.74 -1.58 0.91 0.23 0.96 67.63 59.97 71.14 59.56 46.00 58.95 78.55 69.99 81.04 0.24 -0.20 -0.04 -1.96 -4.27 -2.72 0.64 -0.24 0.73 3DShot2 20
21 RAPTOR 67.54 62.81 72.83 61.77 60.13 63.36 79.10 71.54 80.43 0.56 0.74 0.58 -0.47 0.72 -0.57 1.01 0.47 0.87 67.54 62.81 72.83 61.77 60.13 63.36 79.10 71.54 80.43 0.22 0.35 0.31 -1.14 0.22 -1.34 0.76 0.04 0.62 RAPTOR 21
22 Pcons_local 67.46 62.84 72.88 67.16 59.23 70.06 74.59 70.49 76.48 0.54 0.75 0.59 1.12 0.50 0.98 0.21 0.31 0.33 68.07 64.44 74.50 67.16 59.23 70.06 77.19 72.09 80.18 0.34 0.67 0.64 0.85 -0.06 0.75 0.34 0.14 0.58 Pcons_local 22
23 Pcons_dot_net 67.46 62.84 72.88 67.16 59.23 70.06 74.59 70.49 76.48 0.54 0.75 0.59 1.12 0.50 0.98 0.21 0.31 0.33 68.95 64.39 74.50 67.16 64.87 70.06 77.19 72.09 80.47 0.53 0.66 0.64 0.85 1.73 0.75 0.34 0.14 0.63 Pcons_dot_net 23
24 Pcons_multi 67.46 62.84 72.88 67.16 59.23 70.06 74.59 70.49 76.48 0.54 0.75 0.59 1.12 0.50 0.98 0.21 0.31 0.33 71.40 65.56 75.86 67.16 61.11 70.15 78.96 73.18 80.72 1.07 0.88 0.92 0.85 0.54 0.78 0.73 0.34 0.67 Pcons_multi 24
25 Phyre_de_novo 67.28 64.06 71.51 65.20 61.27 71.60 74.18 70.99 73.14 0.51 0.95 0.36 0.54 1.00 1.34 0.14 0.39 -0.13 68.60 64.68 71.72 65.93 61.36 71.70 75.82 72.36 73.56 0.45 0.71 0.08 0.40 0.62 1.27 0.03 0.19 -0.57 Phyre_de_novo 25
26 SAM−T08−server 67.28 60.73 76.05 69.85 57.27 72.72 75.14 71.40 79.56 0.51 0.40 1.12 1.91 0.02 1.60 0.31 0.45 0.75 67.28 60.97 76.05 69.85 60.13 72.72 75.14 71.40 79.56 0.16 -0.01 0.95 1.85 0.22 1.59 -0.12 0.02 0.47 SAM−T08−server 26
27 HHpred5 66.58 55.88 73.04 66.67 60.46 71.63 76.91 67.17 76.10 0.37 -0.41 0.62 0.97 0.80 1.34 0.62 -0.20 0.27 66.58 55.88 73.04 66.67 60.46 71.63 76.91 67.17 76.10 0.01 -0.99 0.35 0.67 0.33 1.24 0.27 -0.76 -0.13 HHpred5 27
28 METATASSER 65.97 60.41 73.77 63.73 56.21 67.22 77.19 71.54 80.38 0.25 0.34 0.74 0.10 -0.24 0.33 0.67 0.47 0.87 66.32 60.53 73.77 63.97 59.48 67.22 77.19 73.22 80.38 -0.05 -0.09 0.49 -0.33 0.02 -0.13 0.34 0.35 0.61 METATASSER 28
29 3D−JIGSAW_AEP 65.26 61.17 73.67 61.52 57.60 68.16 74.04 69.67 77.95 0.11 0.47 0.72 -0.55 0.10 0.54 0.11 0.19 0.53 65.26 61.17 73.92 62.74 58.25 68.35 74.04 69.99 78.25 -0.28 0.03 0.52 -0.78 -0.37 0.22 -0.37 -0.24 0.24 3D−JIGSAW_AEP 29
30 FFASflextemplate 64.74 58.83 71.85 64.95 55.47 67.31 75.27 72.09 76.17 0.01 0.08 0.42 0.46 -0.42 0.35 0.33 0.56 0.28 64.74 58.83 71.85 64.95 56.21 67.47 75.27 72.09 76.17 -0.40 -0.42 0.11 0.04 -1.02 -0.06 -0.09 0.14 -0.12 FFASflextemplate 30
31 COMA 64.56 58.45 72.89 61.27 58.33 65.86 75.41 70.13 78.81 -0.03 0.02 0.59 -0.62 0.28 0.01 0.36 0.26 0.65 64.56 58.45 72.89 63.23 58.33 70.77 75.41 70.13 78.81 -0.44 -0.50 0.32 -0.60 -0.35 0.98 -0.06 -0.22 0.34 COMA 31
32 mGenTHREADER 64.30 58.04 67.80 60.54 53.35 58.52 73.77 63.21 74.64 -0.08 -0.05 -0.26 -0.84 -0.94 -1.68 0.06 -0.80 0.07 64.30 58.04 67.80 60.54 53.35 58.52 73.77 63.21 74.64 -0.49 -0.57 -0.71 -1.60 -1.93 -2.86 -0.43 -1.50 -0.38 mGenTHREADER 32
33 BAKER−ROBETTA 64.03 60.70 66.55 64.95 61.85 67.05 70.90 67.62 69.51 -0.13 0.39 -0.46 0.46 1.14 0.29 -0.45 -0.13 -0.63 64.74 60.94 68.57 65.69 61.85 69.09 72.00 69.81 71.86 -0.40 -0.01 -0.55 0.31 0.77 0.45 -0.82 -0.28 -0.87 BAKER−ROBETTA 33
34 GeneSilicoMetaServer 64.03 55.15 71.64 60.05 50.90 61.71 76.09 72.45 79.14 -0.13 -0.53 0.38 -0.98 -1.54 -0.95 0.48 0.61 0.69 64.74 60.23 71.64 63.23 59.07 66.84 76.09 72.45 79.14 -0.40 -0.15 0.07 -0.60 -0.11 -0.25 0.09 0.21 0.40 GeneSilicoMetaServer 34
35 COMA−M 63.95 54.18 70.07 66.42 60.87 70.77 72.40 64.07 72.05 -0.14 -0.69 0.12 0.90 0.90 1.15 -0.18 -0.67 -0.28 67.54 61.37 72.89 66.42 60.87 70.77 76.37 72.91 78.81 0.22 0.07 0.32 0.58 0.46 0.98 0.15 0.29 0.34 COMA−M 35
36 fais−server 63.51 57.66 66.63 63.48 53.51 67.25 70.22 67.94 69.60 -0.23 -0.11 -0.45 0.03 -0.90 0.33 -0.57 -0.08 -0.62 63.51 57.66 70.06 63.97 61.03 67.25 71.72 69.26 73.90 -0.67 -0.65 -0.25 -0.33 0.51 -0.13 -0.88 -0.38 -0.51 fais−server 36
37 pipe_int 63.51 57.25 70.34 62.99 55.31 69.01 73.50 70.04 74.62 -0.23 -0.18 0.17 -0.11 -0.46 0.74 0.02 0.24 0.07 63.51 57.25 70.34 62.99 55.31 69.01 73.50 70.04 74.62 -0.67 -0.73 -0.20 -0.69 -1.31 0.43 -0.49 -0.23 -0.39 pipe_int 37
38 3D−JIGSAW_V3 63.51 54.80 71.92 61.52 54.41 64.05 74.45 63.12 77.99 -0.23 -0.59 0.43 -0.55 -0.68 -0.41 0.19 -0.81 0.54 63.51 56.58 72.24 61.52 57.35 64.67 74.45 65.67 78.28 -0.67 -0.86 0.19 -1.24 -0.66 -0.93 -0.27 -1.04 0.25 3D−JIGSAW_V3 38
39 GS−MetaServer2 63.16 54.03 62.36 62.74 56.94 60.47 70.49 67.94 66.90 -0.30 -0.72 -1.16 -0.19 -0.06 -1.23 -0.52 -0.08 -0.99 71.32 64.18 74.40 68.63 62.17 65.27 81.28 78.46 82.27 1.05 0.62 0.62 1.40 0.87 -0.74 1.25 1.32 0.94 GS−MetaServer2 39
40 HHpred4 63.07 58.16 69.26 62.26 54.41 68.17 73.77 64.12 72.83 -0.32 -0.03 -0.01 -0.33 -0.68 0.54 0.06 -0.66 -0.18 63.07 58.16 69.26 62.26 54.41 68.17 73.77 64.12 72.83 -0.76 -0.55 -0.41 -0.96 -1.60 0.16 -0.43 -1.33 -0.70 HHpred4 40
41 FEIG 62.81 54.09 71.09 64.22 56.21 67.03 73.77 67.58 76.11 -0.37 -0.71 0.29 0.25 -0.24 0.28 0.06 -0.13 0.28 66.49 59.12 71.09 65.93 57.52 69.11 78.42 73.77 78.38 -0.01 -0.37 -0.05 0.40 -0.61 0.46 0.61 0.45 0.27 FEIG 41
42 SAM−T02−server 62.10 57.19 68.47 60.78 52.61 62.64 71.31 66.85 73.87 -0.51 -0.19 -0.14 -0.77 -1.12 -0.73 -0.37 -0.24 -0.03 69.91 66.46 73.08 68.63 58.74 63.52 79.37 76.64 80.78 0.74 1.06 0.36 1.40 -0.22 -1.29 0.82 0.98 0.68 SAM−T02−server 42
43 PSI 62.10 54.44 67.26 60.78 52.78 66.29 70.63 64.16 70.80 -0.51 -0.65 -0.34 -0.77 -1.08 0.11 -0.49 -0.65 -0.46 63.77 56.67 69.01 64.95 59.56 68.45 72.40 66.53 72.32 -0.61 -0.84 -0.46 0.04 0.04 0.25 -0.73 -0.88 -0.79 PSI 43
44 SAM−T06−server 61.32 55.35 68.21 62.99 56.78 68.22 69.13 63.02 69.98 -0.66 -0.50 -0.19 -0.11 -0.10 0.56 -0.76 -0.83 -0.57 62.63 58.25 68.21 64.46 59.40 68.22 71.86 68.22 71.33 -0.86 -0.53 -0.63 -0.15 -0.01 0.18 -0.85 -0.57 -0.96 SAM−T06−server 44
45 Frankenstein 61.14 52.13 71.75 55.88 43.71 62.97 75.55 72.09 78.47 -0.69 -1.03 0.40 -2.21 -3.30 -0.66 0.38 0.56 0.60 61.14 54.50 71.75 62.74 52.45 65.66 75.55 72.09 78.47 -1.19 -1.26 0.09 -0.78 -2.22 -0.62 -0.03 0.14 0.28 Frankenstein 45
46 PS2−server 60.88 54.71 66.24 62.50 59.72 65.84 69.94 67.58 70.08 -0.75 -0.60 -0.51 -0.26 0.62 0.01 -0.62 -0.13 -0.56 66.67 61.17 73.85 65.20 60.21 71.22 73.77 69.85 78.21 0.03 0.03 0.51 0.13 0.25 1.12 -0.43 -0.27 0.24 PS2−server 46
47 MUSTER 60.61 50.91 64.57 66.91 59.72 66.49 66.26 61.61 67.40 -0.80 -1.24 -0.79 1.04 0.62 0.16 -1.27 -1.04 -0.93 72.46 65.50 76.31 70.34 64.54 71.24 79.78 77.05 81.57 1.30 0.87 1.01 2.03 1.63 1.12 0.91 1.06 0.82 MUSTER 47
48 CpHModels 60.00 54.21 60.58 62.01 55.47 62.79 68.44 64.25 63.00 -0.92 -0.69 -1.45 -0.40 -0.42 -0.70 -0.88 -0.64 -1.53 60.00 54.21 60.58 62.01 55.47 62.79 68.44 64.25 63.00 -1.44 -1.32 -2.16 -1.06 -1.26 -1.52 -1.61 -1.30 -2.40 CpHModels 48
49 panther_server 60.00 52.52 58.70 59.31 52.94 59.79 67.76 62.02 62.61 -0.92 -0.97 -1.77 -1.20 -1.04 -1.39 -1.00 -0.98 -1.59 63.07 57.43 62.74 59.31 52.94 59.79 70.36 66.53 69.33 -0.76 -0.69 -1.73 -2.06 -2.06 -2.46 -1.19 -0.88 -1.30 panther_server 49
50 Phyre2 59.47 51.70 62.82 63.73 55.88 69.34 67.08 60.52 62.20 -1.02 -1.10 -1.08 0.10 -0.32 0.82 -1.13 -1.21 -1.64 59.47 52.60 62.82 63.73 55.88 69.45 67.08 60.88 62.20 -1.55 -1.63 -1.71 -0.42 -1.13 0.56 -1.92 -1.93 -2.54 Phyre2 50
51 BioSerf 59.39 51.37 66.74 64.71 57.03 66.82 69.40 65.12 69.96 -1.04 -1.16 -0.43 0.39 -0.04 0.23 -0.71 -0.51 -0.57 59.39 51.37 66.74 64.71 57.03 66.82 69.40 65.12 69.96 -1.57 -1.87 -0.92 -0.05 -0.76 -0.26 -1.40 -1.14 -1.19 BioSerf 51
52 Pushchino 59.30 54.33 56.87 57.35 51.31 51.18 65.03 62.11 64.12 -1.05 -0.67 -2.07 -1.78 -1.44 -3.38 -1.49 -0.97 -1.38 59.30 54.33 56.87 57.35 51.31 51.18 65.03 62.11 64.12 -1.59 -1.29 -2.91 -2.78 -2.58 -5.15 -2.37 -1.70 -2.21 Pushchino 52
53 ACOMPMOD 58.68 52.08 64.55 63.23 57.52 63.20 66.12 57.47 67.90 -1.18 -1.04 -0.80 -0.04 0.08 -0.60 -1.30 -1.67 -0.86 60.97 52.28 71.35 63.23 57.52 68.85 73.91 70.54 76.56 -1.22 -1.69 0.01 -0.60 -0.61 0.38 -0.39 -0.14 -0.05 ACOMPMOD 53
54 FUGUE_KM 58.60 51.93 64.15 62.50 57.76 60.45 67.76 59.47 68.90 -1.19 -1.07 -0.86 -0.26 0.14 -1.24 -1.00 -1.37 -0.72 63.60 57.75 70.15 62.50 57.76 65.64 75.00 71.27 75.62 -0.65 -0.63 -0.24 -0.87 -0.53 -0.63 -0.15 -0.01 -0.21 FUGUE_KM 54
55 Poing 58.07 52.05 60.02 63.73 55.88 69.42 65.16 59.52 57.74 -1.29 -1.05 -1.55 0.10 -0.32 0.83 -1.47 -1.36 -2.26 58.68 52.46 60.06 63.73 55.88 69.42 66.12 60.20 57.92 -1.73 -1.66 -2.27 -0.42 -1.13 0.55 -2.13 -2.05 -3.28 Poing 55
56 Phragment 57.98 51.84 60.96 63.73 55.88 69.25 65.30 59.74 59.32 -1.31 -1.08 -1.39 0.10 -0.32 0.79 -1.44 -1.33 -2.04 58.60 52.69 61.27 63.73 55.88 69.38 66.39 60.75 59.78 -1.75 -1.61 -2.02 -0.42 -1.13 0.54 -2.07 -1.95 -2.96 Phragment 56
57 FFASstandard 57.54 50.99 63.02 62.26 58.99 62.38 64.48 59.20 67.36 -1.40 -1.22 -1.05 -0.33 0.44 -0.79 -1.59 -1.41 -0.93 61.75 58.13 64.89 62.74 58.99 63.01 70.08 68.17 69.61 -1.05 -0.56 -1.30 -0.78 -0.14 -1.45 -1.25 -0.58 -1.26 FFASstandard 57
58 keasar−server 57.02 49.36 64.61 65.20 50.65 66.97 65.57 61.29 66.89 -1.50 -1.49 -0.79 0.54 -1.60 0.27 -1.39 -1.09 -1.00 68.60 64.44 73.69 65.20 59.48 70.16 76.50 72.31 78.26 0.45 0.67 0.48 0.13 0.02 0.79 0.18 0.18 0.24 keasar−server 58
59 YASARA 56.84 50.88 61.78 60.54 58.74 63.36 63.80 60.06 62.58 -1.54 -1.24 -1.26 -0.84 0.38 -0.57 -1.71 -1.28 -1.59 56.84 50.88 61.80 60.54 58.74 63.97 63.80 60.06 62.61 -2.13 -1.96 -1.92 -1.60 -0.22 -1.15 -2.65 -2.08 -2.47 YASARA 59
60 FFASsuboptimal 56.32 48.36 63.94 65.93 60.38 65.47 64.34 57.97 66.89 -1.64 -1.66 -0.90 0.75 0.78 -0.08 -1.61 -1.60 -1.00 57.54 50.99 63.94 65.93 60.70 65.47 65.30 61.29 67.36 -1.98 -1.94 -1.49 0.40 0.41 -0.68 -2.31 -1.85 -1.65 FFASsuboptimal 60
61 huber−torda−server 56.23 45.35 50.79 53.43 49.51 48.58 64.07 55.33 56.54 -1.65 -2.16 -3.08 -2.94 -1.88 -3.98 -1.66 -2.00 -2.42 63.60 60.61 67.14 62.50 59.40 64.92 71.04 67.99 72.29 -0.65 -0.08 -0.84 -0.87 -0.01 -0.85 -1.03 -0.61 -0.79 huber−torda−server 61
62 Distill 54.39 48.01 55.15 51.96 49.18 51.71 63.39 59.38 61.36 -2.01 -1.72 -2.36 -3.37 -1.96 -3.26 -1.78 -1.38 -1.76 55.44 48.57 57.10 57.35 55.23 55.06 66.94 61.75 63.74 -2.44 -2.41 -2.87 -2.78 -1.33 -3.94 -1.95 -1.76 -2.27 Distill 62
63 MUFOLD−Server 49.83 39.88 51.79 45.59 38.89 45.16 62.30 53.55 62.03 -2.91 -3.07 -2.92 -5.25 -4.48 -4.77 -1.98 -2.27 -1.67 54.56 46.37 57.13 64.46 60.70 66.56 69.54 64.66 69.58 -2.63 -2.84 -2.86 -0.15 0.41 -0.34 -1.37 -1.23 -1.26 MUFOLD−Server 63
64 OLGAFS 47.72 44.62 40.62 51.72 47.96 38.23 48.91 45.63 43.71 -3.32 -2.28 -4.77 -3.44 -2.26 -6.37 -4.36 -3.48 -4.19 47.72 44.94 40.75 51.72 48.77 38.29 50.27 49.00 44.29 -4.14 -3.11 -6.16 -4.87 -3.39 -9.18 -5.66 -4.12 -5.65 OLGAFS 64
65 mariner1 27.98 22.78 22.85 22.79 17.65 20.10 34.56 30.87 28.77 -7.18 -5.91 -7.72 -11.98 -9.69 -10.55 -6.91 -5.73 -6.25 67.37 62.75 70.50 65.44 64.46 69.71 74.86 68.76 78.12 0.18 0.34 -0.16 0.22 1.60 0.64 -0.18 -0.47 0.22 mariner1 65
66 FOLDpro 17.89 16.96 25.37 18.87 16.50 25.70 27.46 26.18 33.00 -9.16 -6.88 -7.31 -13.14 -9.97 -9.26 -8.17 -6.45 -5.67 58.60 52.69 55.72 52.94 48.69 53.92 68.58 58.65 66.48 -1.75 -1.61 -3.14 -4.42 -3.41 -4.29 -1.58 -2.34 -1.80 FOLDpro 66
67 MUFOLD−MD 17.63 16.73 43.20 39.46 34.07 54.40 26.78 25.23 44.92 -9.21 -6.92 -4.34 -7.06 -5.66 -2.63 -8.29 -6.59 -4.03 18.16 16.73 43.20 40.69 35.38 54.40 26.78 25.23 44.92 -10.63 -8.58 -5.67 -8.96 -7.65 -4.14 -10.90 -8.50 -5.54 MUFOLD−MD 67
68 RBO−Proteus 17.19 15.26 42.03 34.07 31.45 55.63 25.68 23.22 42.07 -9.29 -7.16 -4.54 -8.65 -6.31 -2.35 -8.49 -6.90 -4.42 17.19 15.85 42.08 36.03 33.58 56.18 25.68 23.22 42.36 -10.84 -8.75 -5.89 -10.69 -8.22 -3.59 -11.14 -8.87 -5.98 RBO−Proteus 68
69 RANDOM 8.96 7.40 8.96 17.49 15.18 17.49 12.89 11.49 12.89 -10.90 -8.47 -10.03 -13.54 -10.29 -11.16 -10.76 -8.69 -8.44 8.96 7.40 8.96 17.49 15.18 17.49 12.89 11.49 12.89 -12.65 -10.39 -12.57 -17.57 -14.07 -15.69 -13.99 -11.04 -11.09 RANDOM 69
70 schenk−torda−server 6.93 5.35 5.46 14.71 13.07 12.34 9.84 7.47 8.82 -11.30 -8.81 -10.61 -14.36 -10.81 -12.35 -11.31 -9.30 -9.01 7.19 6.99 6.54 14.71 13.07 18.11 10.93 10.11 8.88 -13.04 -10.47 -13.06 -18.60 -14.74 -15.50 -14.43 -11.29 -11.79 schenk−torda−server 70
71 BHAGEERATH                                                       -10.90 -8.47 -10.03 -13.54 -10.29 -11.16 -10.76 -8.69 -8.44                                                       -12.65 -10.39 -12.57 -17.57 -14.07 -15.69 -13.99 -11.04 -11.09 BHAGEERATH 71
72 forecast                                                       -10.90 -8.47 -10.03 -13.54 -10.29 -11.16 -10.76 -8.69 -8.44                                                       -12.65 -10.39 -12.57 -17.57 -14.07 -15.69 -13.99 -11.04 -11.09 forecast 72
73 mahmood−torda−server                                                       -10.90 -8.47 -10.03 -13.54 -10.29 -11.16 -10.76 -8.69 -8.44                                                       -12.65 -10.39 -12.57 -17.57 -14.07 -15.69 -13.99 -11.04 -11.09 mahmood−torda−server 73
74 test_http_server_01                                                       -10.90 -8.47 -10.03 -13.54 -10.29 -11.16 -10.76 -8.69 -8.44                                                       -12.65 -10.39 -12.57 -17.57 -14.07 -15.69 -13.99 -11.04 -11.09 test_http_server_01 74