Correspondence between target sequence and PDB

For those wanting it quick: download target structures modified to match sequences.

Unfortunately, target sequences often do not correspond to pdb sequences exactly. Since all server models were made for the target sequences, we modified pdb files to match target sequences, both in residue numbers and amino acid types. Here, we show mapping between the two sequences and list changes made to pdb files. For each target, links to raw pdb, modified pdb, PyMOL scripts to display modified pdb and domain definitions, and a link to the target page are provided, followed by an alignment between the target sequence and pdb sequence:

  • in each alignment, the first line is target sequence, the last line is PDB sequence
  • the middle line shows correspondence status for each position:
    •   |   matched
    •   ~  one of the sequences lacks amino acid
    •   :   amino acid in target differs from amino acid in pdb (also shown on yellow background)
    •   *   position removed from pdb as its SD of Cα displacement in NMR models is above 3.5Å cutoff
  • mouse-over amino acid shows residue number
  • pdb sequence is colored by domain from blue to red, gray letters are not included in any domain
  • discrepancies between target and pdb sequences are noted below an alignment, changes made to pdb sequence are listed
  • residue ranges for domains are given
  • in target sequence numbering (target) and pdb file numbering (pdb)
Show each sequence in one line  or enter the number of residues per line (e.g. 70):     

T0387    2vsp.pdb    T0387.pdb    PyMOL    PyMOL of domains    Target page

T0387    1 SMKPKLCRLAKGENGYGFHLNAIRGLPGSFIKEVQKGGPADLAGLEDEDVIIEVNGVNVLDEPYEKVVDRIQSSGKNVTLLVCGKKAQDTV 91
           ~:||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~
2vspA    2 -AKPKLCRLAKGENGYGFHLNAIRGLPGSFIKEVQKGGPADLAGLEDEDVIIEVNGVNVLDEPYEKVVDRIQSSGKNVTLLVCG------- 84

Residue change log: change 2 A to M;

Single domain protein: target 2-84 ; pdb 2-84

T0388    3cyn.pdb    T0388.pdb    PyMOL    PyMOL of domains    Target page

We suggest to evaluate this target as a single domain spanning whole chain. However, N-terminal segment (target 1-8, pdb 36-43) extends away and may be removed, resulting in this domain definition:

1st domain: target 9-174 ; pdb 44-209

T0389    2vsw.pdb    T0389.pdb    PyMOL    PyMOL of domains    Target page

T0389    1 MIGTQIVTERLVALLESGTEKVLLIDSRPFVEYNTSHILEAININCSKLMKRRLQQDKVLITELIQHSAKHKVDIDCSQKVVVYDQSSQDVASLSSDCFLTVLLGKLEKSFNSVHLLAGGFAEFSRCFPGLCEGKSTLVPTCISQPAHHHHHH 153
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~~~~~~~~~~~~~
2vswA    5 MIGTQIVTERLVALLESGTEKVLLIDSRPFVEYNTSHILEAININCSKLMKRRLQQDKVLITELIQHSAKHKVDIDCSQKVVVYDQSSQDVASLSSDCFLTVLLGKLEKSFNSVHLLAGGFAEFSRCFPGLCEG------------------- 138

Single domain protein: target 1-134 ; pdb 5-138

T0390    3czu.pdb    T0390.pdb    PyMOL    PyMOL of domains    Target page

T0390    1 AAPEHHHHHHDYDIPTTENLYFQGAMDAADRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHVNPQEKRLAADDP 182
           ~~~~~~~~~~~~~~~~~~~~~~~~~~~~||||||||||||||||||||||||||||||||||||||~~||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~~~~~~~~~~~~~~~~
3czuA   18 ----------------------------ADRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYE--SVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSG---------------------- 149

Single domain protein: target 29-66, 69-160 ; pdb 18-55, 58-149

T0391    3d89.pdb    T0391.pdb    PyMOL    PyMOL of domains    Target page

T0391    1 SDPEISEQDEEKKKYTSVCVGREEDIRKSERMTAVVHDREVVIFYHKGEYHAMDIRCYHSGGPLHLGEIEDFNGQSCIVCPWHKYKITLATGEGLYQSINPKDPSAKPKWCSKGVKQRIHTVKVDNGNIYVTLSKEPFKCDSDYYATGEFKVIQSSS 157
           ~~~~~~~~~~~~~||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~||||||||||||||||||||||||||||||||||||||||||||||||~~~
3d89A   14 -------------KYTSVCVGREEDIRKSERMTAVVHDREVVIFYHKGEYHAMDIRCYHSGGPLHLGEIEDFNGQSCIVCPWHKYKITLATGEGLYQSINP-----KPKWCSKGVKQRIHTVKVDNGNIYVTLSKEPFKCDSDYYATGEFKVIQ--- 154

We suggest to evaluate this target as a single domain spanning whole chain. However, evolutionarily this is a 2-domain protein, although domains are tightly associated and the boundary between them is not clearly defined:

1st domain: target 14-54, 118-154 ; pdb 14-54, 118-154

2nd domain: target 55-101, 107-117 ; pdb 55-101, 107-117

T0392    2vsv.pdb    T0392.pdb    PyMOL    PyMOL of domains    Target page

T0392    1 MHHHHHHSSGVDLGTENLYFQSMPRSIRFTAEEGDLGFTLRGNAPVQVHFLDPYCSASVAGAREGDYIVSIQLVDCKWLTLSEVMKLLKSFGEDEIEMKVVSLLDEVTF 109
           ~~~~~~~|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~
2vsvA  -15 -------SSGVDLGTENLYFQSMPRSIRFTAEEGDLGFTLRGNAPVQVHFLDPYCSASVAGAREGDYIVSIQLVDCKWLTLSEVMKLLKSFGEDEIEMKVVSLL----- 594

We suggest to evaluate this target as a single domain spanning whole chain. However, N-termial segment (target 1-23, pdb -15-0) is introduced in cloning, protrudes away from the domain in 3D structure (interact with another chain) and can be deleted for domain evaluation, resulting in this domain definition:

1st domain: target 24-104 ; pdb 514-594

T0393    3d1l.pdb    T0393.pdb    PyMOL    PyMOL of domains    Target page

Residue change log: change 95, 104, 120, 185, 203, 241, 248, MSE to MET;

We suggest to evaluate this target as a single domain spanning whole chain. However, evolutionarily this is a 3-domain protein:

1st domain: target 4-123, 127-163 ; pdb 4-123, 127-163

2nd domain: target 164-263 ; pdb 164-263

T0394    3dcy.pdb    T0394.pdb    PyMOL    PyMOL of domains    Target page

Residue change log: change 60, 66, 79, 106, 130, 202, 227, 235, 257, MSE to MET;

Single domain protein: target 1-155, 165-177, 191-269 ; pdb -4-150, 160-172, 186-264

T0395    PDB unreleased    T0395.pdb    PyMOL    PyMOL of domains    Target page

We suggest to evaluate this target as a single domain spanning whole chain. However, evolutionarily this is a 2-domain protein:

1st domain: target 1-86, 104-197 ; pdb 1-103, 104-197

2nd domain: target 198-304 ; pdb 198-304

T0396    PDB unreleased    T0396.pdb    PyMOL    PyMOL of domains    Target page

Single domain protein: target 3-104 ; pdb 3-104

T0397    3d4r.pdb    T0397.pdb    PyMOL    PyMOL of domains    Target page

Residue change log: change 1, 55, 97, 133, 147, MSE to MET; remove -7-HENLYFQG-0 as it is not present in target sequence;

2-domain protein, both domains used in evaluation:

1st domain: target 1-82 ; pdb 1-82

2nd domain: target 83-150 ; pdb 83-150

T0398    3d4o.pdb    T0398.pdb    PyMOL    PyMOL of domains    Target page

Residue change log: change 1, 48, 89, 112, 123, 142, 143, 167, 196, 198, 233, MSE to MET; remove 0 G as it is not present in target sequence;

We suggest to evaluate this target as a single domain spanning whole chain. However, this is a 2-domain protein, duplication. Evolutionarily, this is a domain swap of the last α-helix (structural event), not an insertion of one domain into another (genetic event) after gene duplication and fusion:

1st domain: target 1-39, 42-128, 273-291 ; pdb 1-39, 42-128, 273-291

2nd domain: target 129-272 ; pdb 129-272

T0399    3d4e.pdb    T0399.pdb    PyMOL    PyMOL of domains    Target page

T0399    1 MSMKKTKNWLLVFLTVTFCFLMLGCQSKEDKKGGTKPSNEAALTKTENLDFRLSFNKIKVTTDQNHFSGGTSIEQLKQWFGDPNKSEQRNAGNITLDSYTWVKDGAVINAQLYKNSTVARSISNFSFSREAKIGKEDYDELKIGESYKKVVEKLGEPDVLSQSMSSDKEEMQTVWSSGIKTKSSSATIELYFENGLLKNKTQKDLE 206
           ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||:||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3d4eA   45 --------------------------------------------KTENLDFRLSFNKIKVTTDQNHFSGGTSIEQLKQWFGDPNKSEQRNAGNITLDSYTWVKDGAVINAQLYKNSTVARSISNFSFSREAKIGKEDYDELKIGESYKKIVEKLGEPDVLSQSMSSDKEEMQTVWSSGIKTKSSSATIELYFENGLLKNKTQKDLE 206

Residue change log: change 150 I to V; change 164, 171, MSE to MET;

We suggest to evaluate this target as a single domain spanning whole chain. However, evolutionarily this is a 2-domain protein (a duplication of an ancestral unit):

1st domain: target 45-128 ; pdb 45-128

2nd domain: target 129-206 ; pdb 129-206

T0400    3d8p.pdb    T0400.pdb    PyMOL    PyMOL of domains    Target page

Residue change log: change 77, 83, 104, MSE to MET;

Single domain protein: target 2-149, 152-161 ; pdb 2-149, 152-161

T0401    3d5p.pdb    T0401.pdb    PyMOL    PyMOL of domains    Target page

T0401    1 -MEVIESKWYKKDGASSASIDDVEKLLNTTLPKQYKSFLLWSNGGEGKLGDNYIYIWAIEDVIAYNHDYGIQKYLQKEYWAFGMDGDIGYILHLSDNSIYRVDLGDLDITSIKYIAPSFDDFLGKAIYLNFNKLQNVANNNLTT 143
           ~||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~~~~~
3d5pA    0 GMEVIESKWYKKDGASSASIDDVEKLLNTTLPKQYKSFLLWSNGGEGKLGDNYIYIWAIEDVIAYNHDYGIQKYLQKEYWAFGMDGDIGYILHLSDNSIYRVDLGDLDITSIKYIAPSFDDFLGKAIYLNFNK----------- 132

Residue change log: change 1, 83, MSE to MET; remove 0 G as it is not present in target sequence;

We suggest to evaluate this target as a single domain spanning whole chain. However, N-terminal segment is swapped with another chain. N-terminal segment (target 1-3, pdb 0-3) can be removed for domain evaluation, resulting in this domain definition:

1st domain: target 4-132 ; pdb 4-132

T0402    3db0.pdb    T0402.pdb    PyMOL    PyMOL of domains    Target page

T0402    1 MENELEDKILAILEQHQVGVLTSVQGDFPHARYMTFLHDGLTLYTPSGKELPKTEEVRRNPHVCVLIGYDSPGSAFLEINGLASLEEDESIKERIWENISKDWFQGEDSPSFVVIKIVPEQIRILNSDDDGPDTLDLIG 139
           |||||||||||||||||||||||||||||||||||||||||||||||~~~~||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~|||||||||||||||~~~~~~~~~~~~~
3db0A    1 MENELEDKILAILEQHQVGVLTSVQGDFPHARYMTFLHDGLTLYTPS----PKTEEVRRNPHVCVLIGYDSPGSAFLEINGLASLEEDESIKERIWENISKDWFQ------FVVIKIVPEQIRILN------------- 126

Residue change log: change 1, 34, MSE to MET;

Single domain protein: target 1-47, 52-105, 112-126 ; pdb 1-47, 52-105, 112-126

T0404    3dfe.pdb    T0404.pdb    PyMOL    PyMOL of domains    Target page

T0404    1 MSKRANKLVIVTEKVLLKKVAKIIEEAGATGYTVVDTGGKGSRNVRSTGKPNTSDTDSNVKFEVLTENREMAEKIADQVAIKFFTDYAGIIYICEAEVLYGRTFCGPDGC 110
           ~||||||||||||||||||||||||||||||||||||||~~~~~~~~~~~~~~~~~~||||||||||||||||||||||||||||||||||||||||||||~~~~~~~~~
3dfeA    2 -SKRANKLVIVTEKVLLKKVAKIIEEAGATGYTVVDTGG------------------SNVKFEVLTENREMAEKIADQVAIKFFTDYAGIIYICEAEVLYG--------- 101

Residue change log: change 71, MSE to MET;

Single domain protein: target 2-39, 58-101 ; pdb 2-39, 58-101

T0405    PDB unreleased    T0405.pdb    PyMOL    PyMOL of domains    Target page

2-domain protein, both domains used in evaluation:

1st domain: target 2-73 ; pdb 2-73

2nd domain: target 74-282 ; pdb 74-282

T0406    3di5.pdb    T0406.pdb    PyMOL    PyMOL of domains    Target page

T0406    1 MYQTIEGFLQSWTYETESTQKMLDVLTDESLSQEIAPGHWTLGRVAWHIVTAIPVILSGTGLKFEGETKDYPVPTSAKTIADGYRKVNTAFVEALQSEWTDKDLTTINDFFGRPMPNSIFLMTLINHQNHHRGQMTVLMRQAGLTVPGVYGPAKEEWATAGMEAPKM 167
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~~~~~~~~~~~
3di5A    1 MYQTIEGFLQSWTYETESTQKMLDVLTDESLSQEIAPGHWTLGRVAWHIVTAIPVILSGTGLKFEGETKDYPVPTSAKTIADGYRKVNTAFVEALQSEWTDKDLTTINDFFGRPMPNSIFLMTLINHQNHHRGQMTVLMRQAGLTVPGVY----------------- 150

Residue change log: change 1, 22, 115, 122, 135, 139, MSE to MET;

Single domain protein: target 1-150 ; pdb 1-150

T0407    3e38.pdb    T0407.pdb    PyMOL    PyMOL of domains    Target page

Residue change log: change 45, 118, 153, 183, 195, 209, 233, 319, MSE to MET;

2-domain protein, both domains used in evaluation:

1st domain: target 22-266 ; pdb 22-266

2nd domain: target 267-363 ; pdb 267-363

T0408    3d7i.pdb    T0408.pdb    PyMOL    PyMOL of domains    Target page

T0408    1 MKNEVFFGEGMKVVKEKYPDLYDIIVKLNDTVFTGKTLDYKTQKLIAIGIVASRCDEVAIEKQMKSAMKELGITKEEIADVLRVVLLTSGMPAFTKAMKILEKL 104
           ~~~~~~~|||||||:::|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3d7iA    8 -------GEGMKVVAAAYPDLYDIIVKLNDTVFTGKTLDYKTQKLIAIGIVASRCDEVAIEKQMKSAMKELGITKEEIADVLRVVLLTSGMPAFTKAMKILEKL 104

Residue change log: change 15 A to K; change 16 A to E; change 17 A to K; change 11, 64, 68, 91, 98, MSE to MET;

Single domain protein: target 8-104 ; pdb 8-104

T0409    3d0f.pdb    T0409.pdb    PyMOL    PyMOL of domains    Target page

Residue change log: change 341, MSE to MET; remove 316-NA-317 as it is not present in target sequence;

Single-domain protein:

1st domain: target 32-103 ; pdb 349-420

T0410    3d3l.pdb    T0410.pdb    PyMOL    PyMOL of domains    Target page

T0410    1 MHHHHHHSSGVDLGTENLDFEWTLKAGALEMALKRVYTLLSSWNCLEDFDQIFWGQKSALAEKVRQCWQDDELFSYQFLNGANPMLLRRSTSLPSRLVLPSGMEELRAQLEKELQNGSLFEADFILLDGIPANVIRGEKQYLAAPLVMLKMEPNGKLQPMVIQIQPPNPSSPTPTLFLPSDPPLAWLLAKSWVRNSDFQLHEIQYHLLNTHLVAEVIAVATMRCLPGLHPIFKFLIPHIRYTMEINTRARTQLISDGGIFDKAVSTGGGGHVQLLRRAAAQLTYCSLCPPDDLADRGLLGLPGALYAHDALRLWEIIARYVEGIVHLFYQRDDIVKGDPELQAWCREITEVGLCQAQDRGFPVSFQSQSQLCHFLTMCVFTCTAQHAAINQGQLDWYAWVPNAPCTMRMPPPTTKEDVTMATVMGSLPDVRQACLQMAISWHLSRRQPDMVPLGHHKEKYFSGPKPKAVLNQFRTDLEKLEKEITARNEQLDWPYEYLKPSCIENSVTSDSKGGYGSEFELRRQACGRTRAPPPPPLRSGC 541
           ~~~~~~~~~~~~~~~~~~~~~|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~~~~~~~~~~~~~~~~~~~~~||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
3d3lA  176 ---------------------WTLKAGALEMALKRVYTLLSSWNCLEDFDQIFWGQKSALAEKVRQCWQDDELFSYQFLNGANPMLLRRSTSLPSRLVLPSGMEELRAQLEKELQNGSLFEADFILLDGIPA-----EKQYLAAPLVMLKMEPNGKLQPMVIQIQPPNPSSPTPTLFLPSDPPLAWLLAKSWVRNSDFQLHEIQYHLLNTHLVAEVIAVATMRCLPGLHPIFKFLIPHIRY---------------------------GGHVQLLRRAAAQLTYCSLCPPDDLADRGLLGLPGALYAHDALRLWEIIARYVEGIVHLFYQRDDIVKGDPELQAWCREITEVGLCQAQDRGFPVSFQSQSQLCHFLTMCVFTCTAQHAAINQGQLDWYAWVPNAPCTMRMPPPTTKEDVTMATVMGSLPDVRQACLQMAISWHLS----DMVPLGHHKEKYFSGPKPKAVLNQFRTDLEKLEKEITARNEQLDWPYEYLKPSCIENSVT--------------------------------- 662

We suggest to evaluate this target as a single domain spanning whole chain. However, evolutionarily this is a 2-domain protein:

1st domain: target 22-69, 201-241, 269-444, 449-508 ; pdb 176-223, 355-395, 423-598, 603-662

2nd domain: target 70-132, 138-200 ; pdb 224-286, 292-354

T0411    3d1p.pdb    T0411.pdb    PyMOL    PyMOL of domains    Target page

T0411    1 MWKAVMNAWNGTESQSKNVSNIQSYSFEDMKRIVGKHDPNVVLVDVREPSEYSIVHIPASINVPYRSHPDAFALDPLEFEKQIGIPKPDSAKELIFYCASGKRGGEAQKVASSHGYSNTSLYPGSMNDWVSHGGDKLDL 139
           ~~~~~~~~~~~~~~~~~~~||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3d1pA   20 -------------------SNIQSYSFEDMKRIVGKHDPNVVLVDVREPSEYSIVHIPASINVPYRSHPDAFALDPLEFEKQIGIPKPDSAKELIFYCASGKRGGEAQKVASSHGYSNTSLYPGSMNDWVSHGGDKLDL 139

Residue change log: change 30, 126, MSE to MET;

Single domain protein: target 20-139 ; pdb 20-139

T0412    3d3o.pdb    T0412.pdb    PyMOL    PyMOL of domains    Target page

Residue change log: change 16, 58, 64, 66, 69, 97, 98, 129, 138, MSE to MET;

Single domain protein: target 1-176 ; pdb -2-173

T0413    3d0k.pdb    T0413.pdb    PyMOL    PyMOL of domains    Target page

Residue change log: change 155, 205, 273, 286, MSE to MET;

Single domain protein: target 8-31, 35-219, 222-299 ; pdb 5-28, 32-216, 219-296

T0414    3d0j.pdb    T0414.pdb    PyMOL    PyMOL of domains    Target page

Residue change log: change 1, 77, 101, 102, 111, MSE to MET;

We suggest to evaluate this target as a single domain spanning whole chain. However, N-terminal segment (target 1-8, pdb 0-6) interacts with a symmetry mate, but does not form a swap. This segment can be removed for domain-based evaluation, resulting this domain definition:

1st domain: target 9-140 ; pdb 6-137

T0415    3d6w.pdb    T0415.pdb    PyMOL    PyMOL of domains    Target page

Residue change log: change 127, 192, MSE to MET;

We suggest to evaluate this target as a single domain spanning whole chain. However, evolutionarily this is a 2-domain protein (a duplication with rigid interactions between chromodomain-like duplicates):

1st domain: target 1-54 ; pdb 106-159

2nd domain: target 55-109 ; pdb 160-214

T0416    3d3q.pdb    T0416.pdb    PyMOL    PyMOL of domains    Target page

Residue change log: change 41, 47, 59, 66, 128, 205, 221, 244, 262, 288, 298, 302, 303, MSE to MET;

2-domain protein, both domains used in evaluation:

1st domain: target 6-114, 194-315 ; pdb 6-114, 194-315

2nd domain: target 115-119, 123-193 ; pdb 115-119, 123-193

T0417    3d3s.pdb    T0417.pdb    PyMOL    PyMOL of domains    Target page

T0417    1 SNAMRKDETSNTSPDISVAQPASALRYHLRPPRRNDGAAIHQLVSECPPLDLNSLYAYLLLCEHHAHTCVVAESPGGRIDGFVSAYLLPTRPDVLFVWQVAVHSRARGHRLGRAMLGHILERQECRHVRHLETTVGPDNQASRRTFAGLAGERGAHVSEQPFFDRQAFGGADHDDEMLLRIGPFTHPPH 189
           ~~~~~~~~~~~~~~~~~~~~~~~~~|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~
3d3sA    1 -------------------------RYHLRPPRRNDGAAIHQLVSECPPLDLNSLYAYLLLCEHHAHTCVVAESPGGRIDGFVSAYLLPTRPDVLFVWQVAVHSRARGHRLGRAMLGHILERQECRHVRHLETTVGPDNQASRRTFAGLAGERGAHVSEQPFFDRQAFGGADHDDEMLLRIGPF----- 159

Residue change log: change 90, 152, MSE to MET;

Single domain protein: target 26-184 ; pdb 1-159

T0418    3d6j.pdb    T0418.pdb    PyMOL    PyMOL of domains    Target page

Residue change log: change 41, 81, 124, 189, MSE to MET;

We suggest to evaluate this target as a single domain spanning whole chain. However, evolutionarily this is a 2-domain protein:

1st domain: target 2-16, 86-211 ; pdb 2-16, 86-211

2nd domain: target 17-85 ; pdb 17-85

T0419    3czp.pdb    T0419.pdb    PyMOL    PyMOL of domains    Target page

T0419    1 MFESAEVGHSIDKDTYEKAVIELREALLEAQFELKQQARFPVIILINGIEGAGKGETVKLLNEWMDPRLIEVQSFLRPSDEELERPPQWRFWRRLPPKGRTGIFFGNWYSQMLYARVEGHIKEAKLDQAIDAAERFERMLCDEGALLFKFWFHLSKKQLKERLKALEKDPQHSWKLSPLDWKQSEVYDRFVHYGERVLRRTSRDYAPWYVVEGADERYRALTVGRILLEGLQAALATKERAKRQPHAAPLVSSLDNRGLLDSLDLGQYLDKDAYKEQLAAEQARLAGLIRDKRFRQHSLVAVFEGNDAAGKGGAIRRVTDALDPRQYHIVPIAAPTEEERAQPYLWRFWRHIPARRQFTIFDRSWYGRVLVERIEGFCAPADWLRAYGEINDFEEQLSEYGIIVVKFWLAIDKQTQMERFKEREKTPYKRYKITEEDWRNRDKWDQYVDAVGDMVDRTSTEIAPWTLVEANDKRFARVKVLRTINDAIEAAYKKDK 496
           |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~~~~~~~|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~~~~~~~~~~~||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3czpA    1 MFESAEVGHSIDKDTYEKAVIELREALLEAQFELKQQARFPVIILINGIEGAGKGETVKLLNEWMDPRLIEVQSFLRPSDEELERPPQWRFWRRLPPKGRTGIFFGNWYSQMLYARVEGHIKEAKLDQAIDAAERFERMLCDEGALLFKFWFHLSKKQLKERL-------------SPLDWKQSEVYDRFVHYGERVLRRTSRDYAPWYVVEGADERYRALTVGRILLEGLQAALAT-----------------DNRGLLDSLDLGQYLDKDAYKEQLAAEQARLAGLIRDKRFRQHSLVAVFEGNDAAGKGGAIRRVTDALDPRQYHIVPIAAPTEEERAQPYLWRFWRHIPARRQFTIFDRSWYGRVLVERIEGFCAPADWLRAYGEINDFEEQLSEYGIIVVKFWLAIDKQTQMERFKEREKTPYKRYKITEEDWRNRDKWDQYVDAVGDMVDRTSTEIAPWTLVEANDKRFARVKVLRTINDAIEAAYKKDK 496

Residue change log: change 1, 65, 112, 139, 417, 454, MSE to MET;

2-domain protein, both domains used in evaluation:

1st domain: target 1-163, 177-237 ; pdb 1-176, 177-237

2nd domain: target 255-496 ; pdb 255-496

T0420    3d5n.pdb    T0420.pdb    PyMOL    PyMOL of domains    Target page

Residue change log: change 1, 32, 54, 59, 97, MSE to MET;

Single domain protein: target 1-178 ; pdb 1-178

T0421    3czq.pdb    T0421.pdb    PyMOL    PyMOL of domains    Target page

Residue change log: change 78, 86, 108, 161, 182, 201, 222, 240, 270, MSE to MET;

Single domain protein: target 12-299 ; pdb 12-299

T0422    3d8b.pdb    T0422.pdb    PyMOL    PyMOL of domains    Target page

T0422    1 MHHHHHHSSGVDLGTENLYFQSMVPPIPKQDGGEQNGGMQCKPYGAGPTEPAHPVDERLKNLEPKMIELIMNEIMDHGPPVNWEDIAGVEFAKATIKEIVVWPMLRPDIFTGLRGPPKGILLFGPPGTGKTLIGKCIASQSGATFFSISASSLTSKWVGEGEKMVRALFAVARCQQPAVIFIDEIDSLLSQRGDGEHESSRRIKTEFLVQLDGATTSSEDRILVVGATNRPQEIDEAARRRLVKRLYIPLPEASARKQIVINLMSKEQCCLSEEEIEQIVQQSDAFSGADMTQLCREASLGPIRSLQTADIATITPDQVRPIAYIDFENAFRTVRPSVSPKDLELYENWNKTFGCGK 357
           ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~||||||||||||||||~~~~|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~~~~|||||||||||||||||||||||||||||||||||||||
3d8bA  374 --------------------------------------------------------ERLKNLEPKMIELIMNEIMDHGPPVNWEDIAGVEFAKATIKEIVVWPMLRPDIFTGLRGPPKGILLFGPPGTGKTLIGKCIASQSGATFFSISASSLTSKWVGEGEKMVRALFAVARCQQPAVIFIDEIDSLLSQ------ESSRRIKTEFLVQLDG----SEDRILVVGATNRPQEIDEAARRRLVKRLYIPLPEASARKQIVINLMSKEQCCLSEEEIEQIVQQSDAFSGADMTQLCREASLGPIRSLQT----------VRPIAYIDFENAFRTVRPSVSPKDLELYENWNKTFGCGK 674

We suggest to evaluate this target as a single domain spanning whole chain. However, evolutionarily this is a 2-domain protein:

1st domain: target 57-191, 198-213, 218-250, 340-357 ; pdb 374-508, 515-530, 535-567, 657-674

2nd domain: target 251-308, 319-339 ; pdb 568-625, 636-656

T0423    3d01.pdb    T0423.pdb    PyMOL    PyMOL of domains    Target page

Residue change log: change 10, 53, 146, MSE to MET; remove 1-GTENLYFQG-9 as it is not present in target sequence;

Single domain protein: target 1-19, 25-154 ; pdb 10-33, 34-163

T0424    3d37.pdb    T0424.pdb    PyMOL    PyMOL of domains    Target page

We suggest to evaluate this target as a single domain spanning whole chain. However, evolutionarily, this is a 4-domain protein (a duplication of a β-barrel, each duplicate contains a smaller inserted domain):

1st domain: target 6-44, 52-93 ; pdb 6-44, 52-93

2nd domain: target 94-178 ; pdb 94-178

3rd domain: target 179-207, 278-347 ; pdb 179-207, 278-347

4th domain: target 208-224, 232-254, 257-277 ; pdb 208-224, 232-254, 257-277

T0425    3czx.pdb    T0425.pdb    PyMOL    PyMOL of domains    Target page

Residue change log: change 1, 32, 58, 174, MSE to MET; remove 0 A as it is not present in target sequence;

Single domain protein: target 1-181 ; pdb 1-181

T0426    3da2.pdb    T0426.pdb    PyMOL    PyMOL of domains    Target page

Single domain protein: target 22-283 ; pdb 0-261

T0427    3d3y.pdb    T0427.pdb    PyMOL    PyMOL of domains    Target page

Residue change log: change 1, 47, 89, 192, 289, 312, 353, 378, 382, MSE to MET; remove -2-SNA-0 as it is not present in target sequence;

We suggest to evaluate this target as a single domain spanning whole chain. However, evolutionarily this is a 2-domain protein:

1st domain: target 1-230 ; pdb 1-230

2nd domain: target 231-422 ; pdb 231-422

T0428    3d8h.pdb    T0428.pdb    PyMOL    PyMOL of domains    Target page

T0428    1 MGSSHHHHHHSSGLVPRGSTYKLTLIRHGESEWNKENRFTGWTDVSLSEQGVSEAIEAGRMLLEKGFKFDVVYTSVLKRAIMTTWTVLKELGNINCPIINHWRLNERHYGALQGLNKSETASKFGEDQVKIWRRSFDVPPPVLEKSDPRWPGNELIYKGICPSCLPTTECLKDTVERVKPYFEDVIAPSIMSGKSVLVSAHGNSLRALLYLLEGMTPEQILEVNIPTACPLVLELDDYLKVTKKYYLISEEELKAKMEAVANQGKAK 267
           ~~~~~~~~~~~~~~~~~~~|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~~~~~~~~~~~~~
3d8hA   20 -------------------TYKLTLIRHGESEWNKENRFTGWTDVSLSEQGVSEAIEAGRMLLEKGFKFDVVYTSVLKRAIMTTWTVLKELGNINCPIINHWRLNERHYGALQGLNKSETASKFGEDQVKIWRRSFDVPPPVLEKSDPRWPGNELIYKGICPSCLPTTECLKDTVERVKPYFEDVIAPSIMSGKSVLVSAHGNSLRALLYLLEGMTPEQILEVNIPTACPLVLELDDYLKVTKKYYLI------------------- 248

We suggest to evaluate this target as a single domain spanning whole chain. However, evolutionarily this is a 2-domain protein:

1st domain: target 20-107, 172-248 ; pdb 20-107, 172-248

2nd domain: target 108-171 ; pdb 108-171

T0429    3db3.pdb    T0429.pdb    PyMOL    PyMOL of domains    Target page

T0429    1 MHHHHHHSSGRENLYFQGMWDETELGLYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGE 178
           ~~~~~~~~~~~~~~~~~~~||||||||||||||||||||||||||||||||||||~~~~~~~~~~~~~~~~~||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~
3db3A  127 -------------------WDETELGLYKVNEYVDARDTNMGAWFEAQVVRVTRK-----------------EDVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERP-- 283

Residue change log: change 148, 199, 224, MSE to MET;

2-domain protein, both domains used in evaluation:

1st domain: target 20-55, 73-100 ; pdb 127-162, 180-207

2nd domain: target 101-176 ; pdb 208-283

T0430    3dlz.pdb    T0430.pdb    PyMOL    PyMOL of domains    Target page

We suggest to evaluate this target as a single domain spanning whole chain. However, evolutionarily this is a 2-domain protein:

1st domain: target 29-166 ; pdb 470-607

2nd domain: target 167-357 ; pdb 608-798

T0431    3dax.pdb    T0431.pdb    PyMOL    PyMOL of domains    Target page

T0431    1 MAKKTSSRRRQTGEPPLENGLIPYLGCALQFGANPLEFLRANQRKHGHVFTCKLMGKYVHFITNPLSYHKVLCHGKYFDWKKFHFATSAKAFGHRSIDPMDGNTTENINDTFIKTLQGHALNSLTESMMENLQRIMRPPVSSNSKTAAWVTEGMYSFCYRVMFEAGYLTIFGRDLTRRDTQKAHILNNLDNFKQFDKVFPALVAGLPIHMFRTAHNAREKLAESLRHENLQKRESISELISLRMFLNDTLSTFDDLEKAKTHLVVLWASQANTIPATFWSLFQMIRNPEAMKAATEEVKRTLENAGQKVSLEGNPICLSQAELNDLPVLDSIIKESLRLSSASLNIRTAKEDFTLHLEDGSYNIRKDDIIALYPQLMHLDPEIYPDPLTFKYDRYLDENGKTKTTFYCNGLKLKYYYMPFGSGATICPGRLFAIHEIKQFLILMLSYFELELIEGQAKCPPLDQSRAGLGILPPLNDIEFKYKFKHHHHHH 491
           ~~~~~~|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~~~~|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~
3daxA   24 ------SRRRQTGEPPLENGLIPYLGCALQFGANPLEFLRANQRKHGHVFTCKLMGKYVHFITNPLSYHKVLCHGKYFDWKKFHFATSAKAFGHRSIDPMDGNTTENINDTFIKTLQGHALNSLTESMMENLQRIMR----------AWVTEGMYSFCYRVMFEAGYLTIFGRDLTRRDTQKAHILNNLDNFKQFDKVFPALVAGLPIHMFRTAHNAREKLAESLRHENLQKRESISELISLRMFLNDTLSTFDDLEKAKTHLVVLWASQANTIPATFWSLFQMIRNPEAMKAATEEVKRTLENAGQKVSLEGNPICLSQAELNDLPVLDSIIKESLRLSSASLNIRTAKEDFTLHLEDGSYNIRKDDIIALYPQLMHLDPEIYPDPLTFKYDRYLDENGKTKTTFYCNGLKLKYYYMPFGSGATICPGRLFAIHEIKQFLILMLSYFELELIEGQAKCPPLDQSRAGLGILPPLNDIEFKYKFKHHH--- 505

Single domain protein: target 7-137, 148-488 ; pdb 24-154, 165-505

T0432    3dai.pdb    T0432.pdb    PyMOL    PyMOL of domains    Target page

Single domain protein: target 1-130 ; pdb 979-1108

T0433    3d7l.pdb    T0433.pdb    PyMOL    PyMOL of domains    Target page

Residue change log: change 1, 49, 114, 115, 127, 143, MSE to MET; remove -2-SNA-0 as it is not present in target sequence;

Single domain protein: target 1-199 ; pdb 1-199

T0434    3dal.pdb    T0434.pdb    PyMOL    PyMOL of domains    Target page

We suggest to evaluate this target as a single domain spanning whole chain. However, N-terminal (pdb -10 to -1) and C-terminal (179-186) regions protrude away from the structure and were removed in domain evaluation, resulting in this domain definition:

1st domain: target 26-50, 59-109, 113-197 ; pdb 7-31, 40-90, 94-178

T0435    3db5.pdb    T0435.pdb    PyMOL    PyMOL of domains    Target page

Residue change log: change 98, 99, MSE to MET;

We suggest to evaluate this target as a single domain spanning whole chain. However, the domain is different from the entire chain due to a domain swap of the N-terminal region. Its residue range in PDB is B:4-13, A:14-141. Since no server predicted the swap well, we removed the swapped N-terminal segment (pdb A:4-A:13) for evaluation, resulting this domain definition:

1st domain: target 14-31, 35-59, 71-141 ; pdb 14-31, 35-59, 71-141

T0436    3d6k.pdb    T0436.pdb    PyMOL    PyMOL of domains    Target page

Residue change log: change 104, 152, 157, 164, 179, 204, 250, 309, 405, 414, MSE to MET;

We suggest to evaluate this target as a single domain spanning whole chain. However, evolutionarily this is a 2-domain protein:

1st domain: target 15-38, 317-419 ; pdb 15-38, 317-419

2nd domain: target 39-316 ; pdb 39-316

T0437    2k3i.pdb    T0437.pdb    PyMOL    PyMOL of domains    Target page

T0437    1 --MKDVVDKCSTKGCAIDIGTVIDNDNCTSKFSRFFATREEAESFMTKLKELAAAASSADEGASVAYKIKDLEGQVELDAAFTFSCQAEMIIFELSLRSLA-------- 99
           ~~*******************||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~~
2k3iA    1 MAMKDVVDKCSTKGCAIDIGTVIDNDNCTSKFSRFFATREEAESFMTKLKELAAAASSADEGASVAYKIKDLEGQVELDAAFTFSCQAEMIIFELSLRSLALEHHHHHH 109

Residue change log: remove 1-MA-2, 102-LEHHHHHH-109 as it is not present in target sequence; remove 3-MKDVVDKCSTKGCAIDIGT-21 by 3.5Å SD cutoff;

Single domain protein: target 20-99 ; pdb 22-101

T0438    3d3u.pdb    T0438.pdb    PyMOL    PyMOL of domains    Target page

We suggest to evaluate this target as a single domain spanning whole chain. However, evolutionarily this is a 2-domain protein:

1st domain: target 2-80, 101-185 ; pdb 2-80, 101-185

2nd domain: target 186-189, 192-322, 337-374, 381-430 ; pdb 186-189, 192-322, 337-374, 381-430

T0440    3dcp.pdb    T0440.pdb    PyMOL    PyMOL of domains    Target page

Residue change log: change 1, 23, 48, 63, 65, 75, 179, 204, MSE to MET; remove 276-LE-277 as it is not present in target sequence;

Single domain protein: target 1-275 ; pdb 1-275

T0441    3d8u.pdb    T0441.pdb    PyMOL    PyMOL of domains    Target page

T0441    1 MSEPRKRRSTGNVTLADVAKQAGVGTMTVSRALRTPELVSDKLREKIQQVVDELGYIPNKAAGALASAESYSIALIIPSLFEKACAHFLPSFQQALNKAGYQLLLGYSDYSIEQEEKLLSTFLESRPAGVVLFGSEHSQRTHQLLEASNTPVLEIAELSSKASYLNIGVDHFEVGKACTRHLIEQGFKNVGFIGARGNHSTLQRQLHGWQSAMIENYLTPDHFLTTHEAPSSQLGAEGLAKLLLRDSSLNALVCSHEEIAIGALFECHRRVLKVPTDIAIICLEGSSMGEHAYPSLTSAEFDYERMGTKAAEKLLHAIKGEPEERPTSMGFKLKRRASTAIN 342
           ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~|||||||||||||~~
3d8uA   71 ----------------------------------------------------------------------YSIALIIPSLFEKACAHFLPSFQQALNKAGYQLLLGYSDYSIEQEEKLLSTFLESRPAGVVLFGSEHSQRTHQLLEASNTPVLEIAELSSKASYLNIGVDHFEVGKACTRHLIEQGFKNVGFIGARGNHSTLQRQLHGWQSAMIENYLTPDHFLTTHEAPSSQLGAEGLAKLLLRDSSLNALVCSHEEIAIGALFECHRRVLKVPTDIAIICLEGSSMGEHAYPSLTSAEFDYERMGTKAAEKLLHAIKGE------SMGFKLKRRASTA-- 340

Residue change log: change 213, 288, 306, 329, MSE to MET;

We suggest to evaluate this target as a single domain spanning whole chain. However, evolutionarily this is a 2-domain protein:

1st domain: target 71-170, 302-321, 328-329 ; pdb 71-170, 302-321, 328-329

2nd domain: target 171-301, 330-340 ; pdb 171-301, 330-340

T0442    3db9.pdb    T0442.pdb    PyMOL    PyMOL of domains    Target page

We suggest to evaluate this target as a single domain spanning whole chain. However, evolutionarily this is a 2-domain protein:

1st domain: target 11-124, 233-266 ; pdb 11-124, 233-266

2nd domain: target 131-138, 147-189, 197-232 ; pdb 131-138, 147-189, 197-232

T0443    3dee.pdb    T0443.pdb    PyMOL    PyMOL of domains    Target page

T0443    1 MQPETSAQYQHRFSQAIRGGEAADGLPQDRLNVYIRLIRNNIHSFIDRCYTETRQYFDSKEWSRLKEGFVRDARAQTPYFQEIPGEFLQYCQSPPLSDGILALMDFEYTQLLAEVAQIPDIPDIHYSNDSKYTPSPAAFIRQYRYDVTHDLQEAETALLIWRNAEDDVMYQTLDGFDMMLLEIMGSSALSFDTLAQTLVEFMPKADNWKNILLGKWSGWIEQRIIIPSLSAISENMEGNSPSQNHLSA 248
           ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||:||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~~~~~~~~~~~~
3deeA   31 ------------------------------LNVYIRLIRNNIHSFIDRCYTETRQYFDSKEWSRLKEGFVRDARAQTPYFQEIPGEFLQYCQSLPLSDGILALMDFEYTQLLAEVAQIPDIPDIHYSNDSKYTPSPAAFIRQYRYDVTHDLQEAETALLIWRNAEDDVMYQTLDGFDMMLLEIMGSSALSFDTLAQTLVEFMPKADNWKNILLGKWSGWIEQRIIIPSLS------------------ 230

Residue change log: change 94 L to P; change 104, 169, 178, 179, 184, 202, MSE to MET;

2-domain protein, both domains used in evaluation:

1st domain: target 31-116 ; pdb 31-116

2nd domain: target 117-230 ; pdb 117-230

T0444    2vux.pdb    T0444.pdb    PyMOL    PyMOL of domains    Target page

Single domain protein: target 34-41, 47-103, 110-316 ; pdb 30-37, 43-99, 106-312

T0445    3dao.pdb    T0445.pdb    PyMOL    PyMOL of domains    Target page

Residue change log: change 1, 26, 83, 91, 94, 133, 223, MSE to MET; remove 0 G as it is not present in target sequence;

We suggest to evaluate this target as a single domain spanning whole chain. However, evolutionarily this is a 2-domain protein:

1st domain: target 1-81, 190-264 ; pdb 1-81, 190-264

2nd domain: target 82-189 ; pdb 82-189

T0446    3dcx.pdb    T0446.pdb    PyMOL    PyMOL of domains    Target page

Residue change log: change 0 G to M; change 27, 43, 87, MSE to MET;

Single domain protein: target 8-124 ; pdb 0-124

T0447    3do6.pdb    T0447.pdb    PyMOL    PyMOL of domains    Target page

T0447    1 -MKPIKEIADQLELKDDILYPYGHYIAKIDHRFLKSLENHEDGKLILVTAVTPTPAGEGKTTTSIGLSMSLNRIGKKSIVTLREPSLGPTLGLKGGATGGGRSRVLPSDEINLHFTGDMHAVASAHNLLAAVLDSHIKHGNELKIDITRVFWKRTMDMNDRALRSIVIGLGGSANGFPREDSFIITAASEVMAILALSENMKDLKERLGKIIVALDADRKIVRISDLGIQGAMAVLLKDAINPNLVQTTEGTPALIHCGPFANIAHGTNSIIATKMAMKLSEYTVTEAGFGADLGAEKFIDFVSRVGGFYPNAAVLVATVRALKYHGGANLKNIHEENLEALKEGFKNLRVHVENLRKFNLPVVVALNRFSTDTEKEIAYVVKECEKLGVRVAVSEVFKKGSEGGVELAKAVAEAAKDVEPAYLYEMNDPVEKKIEILAKEIYRAGRVEFSDTAKNALKFIKKHGFDELPVIVAKTPKSISHDPSLRGAPEGYTFVVSDLFVSAGAGFVVALSGDINLMPGLPKKPNALNMDVDDSGNIVGVS 542
           ~||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3do6A    0 GMKPIKEIADQLELKDDILYPYGHYIAKIDHRFLKSLENHEDGKLILVTAVTPTPAGEGKTTTSIGLSMSLNRIGKKSIVTLREPSLGPTLGLKGGATGGGRSRVLPSDEINLHFTGDMHAVASAHNLLAAVLDSHIKHGNELKIDITRVFWKRTMDMNDRALRSIVIGLGGSANGFPREDSFIITAASEVMAILALSENMKDLKERLGKIIVALDADRKIVRISDLGIQGAMAVLLKDAINPNLVQTTEGTPALIHCGPFANIAHGTNSIIATKMAMKLSEYTVTEAGFGADLGAEKFIDFVSRVGGFYPNAAVLVATVRALKYHGGANLKNIHEENLEALKEGFKNLRVHVENLRKFNLPVVVALNRFSTDTEKEIAYVVKECEKLGVRVAVSEVFKKGSEGGVELAKAVAEAAKDVEPAYLYEMNDPVEKKIEILAKEIYRAGRVEFSDTAKNALKFIKKHGFDELPVIVAKTPKSISHDPSLRGAPEGYTFVVSDLFVSAGAGFVVALSGDINLMPGLPKKPNALNMDVDDSGNIVGVS 542

Residue change log: change 1, 68, 118, 155, 157, 191, 200, 232, 275, 277, 426, 518, 530, MSE to MET; remove 0 G as it is not present in target sequence;

We suggest to evaluate this target as a single domain spanning whole chain. However, evolutionarily this is a 3-domain protein:

1st domain: target 1-117, 239-422 ; pdb 1-117, 239-422

2nd domain: target 118-238 ; pdb 118-238

3rd domain: target 423-516 ; pdb 423-516

T0448    3dc7.pdb    T0448.pdb    PyMOL    PyMOL of domains    Target page

Residue change log: change 72, 109, 117, 118, 169, 186, MSE to MET;

Single domain protein: target 18-230 ; pdb 18-230

T0449    3dcd.pdb    T0449.pdb    PyMOL    PyMOL of domains    Target page

Residue change log: change 1, 9, 34, 118, 136, 163, 274, 289, MSE to MET;

Single domain protein: target 1-300 ; pdb 1-300

T0450    3da1.pdb    T0450.pdb    PyMOL    PyMOL of domains    Target page

T0450    1 MFSAKKRDKCIGEMSEKQLDLLVIGGGITGAGIALDAQVRGIQTGLVEMNDFASGTSSRSTKLVHGGLRYLKQFEIKLVAEVGKERAIVYENAPHVTTPEWMLLPIFKDGTFGKFSTSLGLKVYDYLADVRKDERRYMLNEKQTLEKEPLLRKENLKGGGIYVEYRTDDARLTLEIMKEAVARGAVALNYMKVESFIYDQGKVVGVVAKDRLTDTTHTIYAKKVVNAAGPWVDTLREKDRSKHGKYLKLSKGVHLVVDQSRFPLRQAVYFDTESDGRMIFAIPREGKTYIGTTDTFYDKDIASPRMTVEDRDYILAAANYMFPSLNLTADDVESSWAGLRPLIHEEGKKASEISRKDEIFFSDSGLISIAGGKLTGYRKMAERTVDAVAQGLNVNEPCTTAAIRLSGGLAEGAQGFPRFLDEASRKGAKLGFDADEVRRLAKLYGSNVDHVLNYAYEGKEEAEHYGLPALLLGQLQYGVEQEMVATPLDFFVRRTGALFFNISLVHQWKEAVLRWMAEEFSWTEEEKTRFQNELETELKMAVDPLFQVEPTTVLEHHHHHH 561
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~~~~~~~~~|||||||||||||||||||||||||||~~~~~~~~~~~~~~~~~~~~~~~~~~~||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||:|||||||||||||||||||~~~~~~~~~~~|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~~~~~~
3da1A    1 MFSAKKRDKCIGEMSEKQLDLLVIGGGITGAGIALDAQVRGIQTGLVEMNDFASGTSSRSTKLVHG---------------VGKERAIVYENAPHVTTPEWMLLPIFK---------------------------RYMLNEKQTLEKEPLLRKENLKGGGIYVEYRTDDARLTLEIMKEAVARGAVALNYMKVESFIYDQGKVVGVVAKDRLTDTTHTIYAKKVVNAAGPWVDTLREKDRSKHGKYLKLSKGVHLVVDQSRFPLRQAVYFDTESDGRMIFAIPREGKTYIGTTDTFYDKDIASPRMTVEDRDYILAAANYMFPSLRLTADDVESSWAGLRPLIHE-----------DEIFFSDSGLISIAGGKLTGYRKMAERTVDAVAQGLNVNEPCTTAAIRLSGGLAEGAQGFPRFLDEASRKGAKLGFDADEVRRLAKLYGSNVDHVLNYAYEGKEEAEHYGLPALLLGQLQYGVEQEMVATPLDFFVRRTGALFFNISLVHQWKEAVLRWMAEEFSWTEEEKTRFQNELETELKMAVDPLFQVE------------ 549

Residue change log: change 326 R to N; change 1, 14, 49, 102, 138, 177, 191, 278, 306, 321, 380, 483, 516, 540, MSE to MET;

We suggest to evaluate this target as a single domain spanning whole chain. However, evolutionarily this is a 5-domain protein:

1st domain: target 1-62, 168-247, 343-345, 357-406 ; pdb 1-62, 168-247, 343-345, 357-406

2nd domain: target 63-66, 82-101, 163-167 ; pdb 63-66, 82-101, 163-167

3rd domain: target 102-108, 136-162 ; pdb 102-108, 136-162

4th domain: target 248-342 ; pdb 248-342

5th domain: target 407-549 ; pdb 407-549

T0451    3dmc.pdb    T0451.pdb    PyMOL    PyMOL of domains    Target page

Residue change log: change 1, 2, 35, 46, MSE to MET; remove 0 G as it is not present in target sequence;

Single domain protein: target 1-133 ; pdb 1-133

T0452    3do5.pdb    T0452.pdb    PyMOL    PyMOL of domains    Target page

Residue change log: change 1, 58, 64, 126, 137, 146, 179, 285, 289, MSE to MET;

We suggest to evaluate this target as a single domain spanning whole chain. However, evolutionarily this is a 2-domain protein:

1st domain: target 1-90, 95-144, 304-324 ; pdb 1-90, 95-144, 304-324

2nd domain: target 145-303 ; pdb 145-303

T0453    3ded.pdb    T0453.pdb    PyMOL    PyMOL of domains    Target page

T0453    1 DGEEDEIVQREDGSWLVDGMVSLDRFREFFELEAPLPGEAGGNIHTLAGVMLYQLGRVPSVTDRFEWNGFSFEVVDMDRTRVDKILVQRHH 91
           ~~~~|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3dedA  341 ----DEIVQREDGSWLVDGMVSLDRFREFFELEAPLPGEAGGNIHTLAGVMLYQLGRVPSVTDRFEWNGFSFEVVDMDRTRVDKILVQRHH 427

Residue change log: change 356, 387, 413, MSE to MET;

Single domain protein: target 5-91 ; pdb 341-427

T0454    3dew.pdb    T0454.pdb    PyMOL    PyMOL of domains    Target page

Residue change log: change 11, 41, 81, 136, 157, 195, MSE to MET;

We suggest to evaluate this target as a single domain spanning whole chain. However, evolutionarily this is a 2-domain protein:

1st domain: target 5-56 ; pdb 5-56

2nd domain: target 57-196 ; pdb 57-196

T0455    3ddv.pdb    T0455.pdb    PyMOL    PyMOL of domains    Target page

We suggest to evaluate this target as a single domain spanning whole chain. However, evolutionarily this is a 2-domain protein:

1st domain: target 3-60 ; pdb 3-60

2nd domain: target 83-145 ; pdb 83-145

T0456    3dfa.pdb    T0456.pdb    PyMOL    PyMOL of domains    Target page

We suggest to evaluate this target as a single domain spanning whole chain. However, evolutionarily this is a 2-domain protein:

1st domain: target 15-104 ; pdb -2-87

2nd domain: target 105-105, 107-154, 159-284 ; pdb 89-89, 90-137, 142-267

T0457    3dev.pdb    T0457.pdb    PyMOL    PyMOL of domains    Target page

Residue change log: change 1, 9, 172, 192, 200, 255, MSE to MET;

2-domain protein, both domains used in evaluation:

1st domain: target 1-194 ; pdb 1-194

2nd domain: target 195-316 ; pdb 195-316

T0458    3dex.pdb    T0458.pdb    PyMOL    PyMOL of domains    Target page

T0458    1 MVGAPRMTTPHTHRVQIEYCTQCRWLPRAAWLAQELLTTFETELTELALKPGTGGVFVVRVDDEVVWDRREQGFPEPTAVKRLVRDRVAPEKSLGHSERLEHHHHHH 107
           ~~~~~~~~~~|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~~~~~~~~~~~~
3dexA   11 ----------HTHRVQIEYCTQCRWLPRAAWLAQELLTTFETELTELALKPGTGGVFVVRVDDEVVWDRREQGFPEPTAVKRLVRDRVA------------------ 89

Single domain protein: target 11-89 ; pdb 11-89

T0459    3df8.pdb    T0459.pdb    PyMOL    PyMOL of domains    Target page

Residue change log: change 1, 27, 87, 94, MSE to MET;

We suggest to evaluate this target as a single domain spanning whole chain. However, due to a domain swap of the N-terminal β-hairpin, the compact domain is different from the entire chain. Its residue range in PDB is B:-2-22, A:23-106. Since no server predicted the swap well, we removed the swapped N-terminal segment (pdb A:-2-A:22) for evaluation, resulting this domain definition:

1st domain: target 26-109 ; pdb 23-106

T0460    2k4n.pdb    T0460.pdb    PyMOL    PyMOL of domains    Target page

Residue change log: remove 53-VEPGEYDPPEMKYT-66, 104-LEHHHHHH-111 by 3.5Å SD cutoff;

Single domain protein: target 1-52, 67-103 ; pdb 1-52, 67-103

T0461    3dh1.pdb    T0461.pdb    PyMOL    PyMOL of domains    Target page

T0461    1 MHHHHHHSSGVDLGTENLYFQSMEETEKWMEEAMHMAKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLDWCRQSGKSPSEVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIASADLPNTGRPFQCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRK 189
           ~~~~~~~~~~~~~~~||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~~~~~~
3dh1A   12 ---------------ENLYFQSMEETEKWMEEAMHMAKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLDWCRQSGKSPSEVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIASADLPNTGRPFQCIPGYRAEEAVEMLKTFYKQ------------ 173

Single domain protein: target 16-177 ; pdb 12-173

T0462    2k5i.pdb    T0462.pdb    PyMOL    PyMOL of domains    Target page

Residue change log: remove 155-LEHHHHHH-162 as it is not present in target sequence; remove 147-GEESHPQK-154 by 3.5Å SD cutoff;

2-domain protein, both domains used in evaluation:

1st domain: target 1-75 ; pdb 1-75

2nd domain: target 76-146 ; pdb 76-146

T0463    3dhn.pdb    T0463.pdb    PyMOL    PyMOL of domains    Target page

Residue change log: change 109, 125, 150, 166, 182, 201, MSE to MET; remove 220-LEHHH-224 as it is not present in target sequence;

Single domain protein: target 3-77, 84-219 ; pdb 3-77, 84-219

T0464    2k5r.pdb    T0464.pdb    PyMOL    PyMOL of domains    Target page

T0464    1 MDRKLLHLLCSPDTRQPLSLLESKGLEALNKAIASGTVQRADGSIQNQSLHEALITRDRKQVFRIEDSIPVLLPEEAIATIQIANFPDK-------- 89
           ***************||||||||||||||||||:||||||||||||||||||||||||||||||||||||||||||||||||||||||*~~~~~~~~
2k5rA    1 MDRKLLHLLCSPDTRQPLSLLESKGLEALNKAIVSGTVQRADGSIQNQSLHEALITRDRKQVFRIEDSIPVLLPEEAIATIQIANFPDKLEHHHHHH 97

Residue change log: change 34 V to A; remove 90-LEHHHHHH-97 as it is not present in target sequence; remove 1-MDRKLLHLLCSPDTR-15, 89-K-89 by 3.5Å SD cutoff;

Single domain protein: target 16-88 ; pdb 16-88

T0465    3dfd.pdb    T0465.pdb    PyMOL    PyMOL of domains    Target page

T0465    1 MSENQNEKVYDLSFFMPGQTIDAEEVEVPISKRFVDKEGNVVPFIFKAITTDRIDELEKENTTYKNVKGRGRVKELDSQRFYARIAVETTVYPTFKAKELREAYKTEDPVEVAKRVLSVGGEYANWLNKAIEINGFDDDLEDLEEAAKNLEHHHHHH 157
           ~~~~~~|||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~~~~||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~~~~~~~~~~~~~~
3dfdA    7 ------EKVYDLSFFMPGQTIDAEEVEVPISKRFVDKEGNVVPFIFKAITTDRIDELEKENTT----------KELDSQRFYARIAVETTVYPTFKAKELREAYKTEDPVEVAKRVLSVGGEYANWLNKAIEINGFD-------------------- 137

Residue change log: change 16, MSE to MET;

We suggest to evaluate this target as a single domain spanning whole chain. However, N-terminal segment (target 1-20, pdb 7-20) forms crystal contacts, but does not interact with its own chain. This segment can be removed for domain-based evaluation, resulting this domain definition:

1st domain: target 21-63, 74-137 ; pdb 21-63, 74-137

T0466    2k5d.pdb    T0466.pdb    PyMOL    PyMOL of domains    Target page

T0466    1 MMRLANGIVLDKDTTFGELKFSALRREVRIQNEDGSVSDEIKERTYDLKSKGQGRMIQVSIPASVPLKEFDYNARVELINPIADTVATATYQGADVDWYIKADDIVLTKDSSSFKAQPQAKKEPTQDK-- 128
           *************||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||********|||||||||||||~~~~~~~~~~~~~~~~~~~~~~
2k5dA    1 MMRLANGIVLDKDTTFGELKFSALRREVRIQNEDGSVSDEIKERTYDLKSKGQGRMIQVSIPASVPLKEFDYNARVELINPIADTVATATYQGADVDWYIKADDIVLT--------------------LE 110

Residue change log: remove 109-LE-110 as it is not present in target sequence; remove 1-MMRLANGIVLDKD-13, 88-TATYQGAD-95 by 3.5Å SD cutoff;

Single domain protein: target 14-87, 96-108 ; pdb 14-87, 96-108

T0467    2k5q.pdb    T0467.pdb    PyMOL    PyMOL of domains    Target page

T0467    1 MDLNRMGKDEYYVQITVDGKEVHSKADNGQKYKDYEYKLTGFDKDGKEKELEFTAQKNLRKEAFLRVYHSDKKGVSAWEEVKKDELPAKVKEKLGVK-------- 97
           *******|||||||||||||||||||***|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||***~~~~~~~~
2k5qA    1 MDLNRMGKDEYYVQITVDGKEVHSKADNGQKYKDYEYKLTGFDKDGKEKELEFTAQKNLRKEAFLRVYHSDKKGVSAWEEVKKDELPAKVKEKLGVKLEHHHHHH 105

Residue change log: remove 98-LEHHHHHH-105 as it is not present in target sequence; remove 1-MDLNRMG-7, 27-DNG-29, 95-GVK-97 by 3.5Å SD cutoff;

Single domain protein: target 8-26, 30-94 ; pdb 8-26, 30-94

T0468    2k5w.pdb    T0468.pdb    PyMOL    PyMOL of domains    Target page

Residue change log: remove 110-LE-111 as it is not present in target sequence; remove 1-MERASLNRIG-10, 56-KEND-59, 77-NSKNEISS-84 by 3.5Å SD cutoff;

Single domain protein: target 11-55, 60-76, 85-109 ; pdb 11-55, 60-76, 85-109

T0469    2k5e.pdb    T0469.pdb    PyMOL    PyMOL of domains    Target page

T0469    1 MTQKFTKDMTFAQALQTHPGVAGVLRSYNLGCIGCMGAQNESLEQGANAHGLNVEDILRDLNALA-------- 65
           |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~~
2k5eA    1 MTQKFTKDMTFAQALQTHPGVAGVLRSYNLGCIGCMGAQNESLEQGANAHGLNVEDILRDLNALALEHHHHHH 73

Residue change log: remove 66-LEHHHHHH-73 as it is not present in target sequence;

Single domain protein: target 1-65 ; pdb 1-65

T0470    3djb.pdb    T0470.pdb    PyMOL    PyMOL of domains    Target page

Residue change log: change 36, 53, 73, 100, 146, 184, 200, 208, MSE to MET;

We suggest to evaluate this target as a single domain spanning whole chain. However, evolutionarily this is a 2-domain protein. (Not a very good quality structure with three disordered loops. Domain break is placed in one of those disordered loop of 11 residues long):

1st domain: target 2-62, 65-100 ; pdb 2-62, 65-100

2nd domain: target 112-154, 167-214 ; pdb 112-154, 167-214

T0471    2k4m.pdb    T0471.pdb    PyMOL    PyMOL of domains    Target page

T0471    1 --------------------MWNDLAVYIIRCSGPGTRVVEVGAGRFLYVSDYIRKHSKVDLVLTDIKPSHGGIVRDDITSPRMEIYRGAALIYSIRPPAEIHSSLMRVADAVGARLIIKPLTGEDIVTERKMKLVNYGRTYFYEYIAEVRSR 133
           ~~~~~~~~~~~~~~~~~~~~|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||**
2k4mA    1 MGSSHHHHHHSSGLVPRGSHMWNDLAVYIIRCSGPGTRVVEVGAGRFLYVSDYIRKHSKVDLVLTDIKPSHGGIVRDDITSPRMEIYRGAALIYSIRPPAEIHSSLMRVADAVGARLIIKPLTGEDIVTERKMKLVNYGRTYFYEYIAEVRSR 153

Residue change log: remove 1-MGSSHHHHHHSSGLVPRGSH-20 as it is not present in target sequence; remove 152-SR-153 by 3.5Å SD cutoff;

Single domain protein: target 1-131 ; pdb 21-151

T0472    2k49.pdb    T0472.pdb    PyMOL    PyMOL of domains    Target page

T0472    1 MSGWYELSKSSNDQFKFVLKAGNGEVILTSELYTGKSGAMNGIESVQTNSPIEARYAKEVAKNDKPYFNLKAANHQIIGTSQMYSSTAARDNGIKSVMENGKTTTIKDLT-------- 110
           *|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~~
2k49A    1 MSGWYELSKSSNDQFKFVLKAGNGEVILTSELYTGKSGAMNGIESVQTNSPIEARYAKEVAKNDKPYFNLKAANHQIIGTSQMYSSTAARDNGIKSVMENGKTTTIKDLTLEHHHHHH 118

Residue change log: remove 111-LEHHHHHH-118 as it is not present in target sequence; remove 1 M by 3.5Å SD cutoff;

2-domain protein, both domains used in evaluation:

1st domain: target 2-50, 102-110 ; pdb 2-50, 102-110

2nd domain: target 51-101 ; pdb 51-101

T0473    2k53.pdb    T0473.pdb    PyMOL    PyMOL of domains    Target page

T0473    1 MKITKDMIIADVLQMDRGTAPIFINNGMHCLGCPSSMGESIEDACAVHGIDADKLVKELNEYFEKKEV-- 68
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~
2k53A    1 MKITKDMIIADVLQMDRGTAPIFINNGMHCLGCPSSMGESIEDACAVHGIDADKLVKELNEYFEKKEVLE 70

Single domain protein: target 1-68 ; pdb 1-68

T0474    2k5j.pdb    T0474.pdb    PyMOL    PyMOL of domains    Target page

Residue change log: remove 1-MNSLAG-6, 53-TARTSVPGIWQGCEEDGVEYQRKLREEW-80 by 3.5Å SD cutoff;

Single domain protein: target 7-52 ; pdb 7-52

T0475    2k54.pdb    T0475.pdb    PyMOL    PyMOL of domains    Target page

Residue change log: change 1 M to L; remove 123 S as it is not present in target sequence;

Single domain protein: target 1-122 ; pdb 1-122

T0476    2k5c.pdb    T0476.pdb    PyMOL    PyMOL of domains    Target page

T0476    1 SAKCPICGSPLKWEELIEEMLIIENFEEIVKDRERFLAQVEEFVFKCPVCGEEFYGKTLPRREAEKVFELLNDFKGGIDWENKRVKLKLNDLLALETMLEEWDRRVKR 108
           :|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~~~~~~~~~~~~~~
2k5cA    8 MAKCPICGSPLKWEELIEEMLIIENFEEIVKDRERFLAQVEEFVFKCPVCGEEFYGKTLPRREAEKVFELLNDFKGGIDWENKRVKLK-------------------- 95

Residue change log: change 8 M to S;

Single domain protein: target 1-88 ; pdb 8-95

T0477    3dkp.pdb    T0477.pdb    PyMOL    PyMOL of domains    Target page

Single domain protein: target 1-191, 194-242 ; pdb 137-327, 330-378

T0478    3d19.pdb    T0478.pdb    PyMOL    PyMOL of domains    Target page

2-domain protein, both domains used in evaluation:

1st domain: target 4-137 ; pdb 11-144

2nd domain: target 138-267 ; pdb 145-274

T0479    3dkz.pdb    T0479.pdb    PyMOL    PyMOL of domains    Target page

Residue change log: change 49, 87, 112, 117, MSE to MET;

Single domain protein: target 6-130 ; pdb 39-163

T0480    2k4x.pdb    T0480.pdb    PyMOL    PyMOL of domains    Target page

T0480    1 MQKRELYEIADGKLVRKHRFCPRCGPGVFLAEHADRYSCGRCGYTEFKKAKKSKS 55
           ****************||||||||||||||||||||||||||||||||||*****
2k4xA    1 MQKRELYEIADGKLVRKHRFCPRCGPGVFLAEHADRYSCGRCGYTEFKKAKKSKS 55

Residue change log: remove 1-MQKRELYEIADGKLVR-16, 51-KKSKS-55 by 3.5Å SD cutoff;

Single domain protein: target 17-50 ; pdb 17-50

T0481    3dka.pdb    T0481.pdb    PyMOL    PyMOL of domains    Target page

Residue change log: change 39, 125, 142, 154, MSE to MET;

Single domain protein: target 5-69, 74-106, 110-154 ; pdb 5-69, 74-106, 110-154

T0482    2k4v.pdb    T0482.pdb    PyMOL    PyMOL of domains    Target page

Residue change log: remove 1-QGH-3, 124-GS-125 as it is not present in target sequence; remove 16-PGLD-19, 84-KFGAITRV-91, 111-GEPVDLERIIRHE-123 by 3.5Å SD cutoff;

Single domain protein: target 1-12, 17-80, 89-107 ; pdb 4-15, 20-83, 92-110

T0483    3dls.pdb    T0483.pdb    PyMOL    PyMOL of domains    Target page

T0483    1 MALEEPPKAVELEGLAACEGEYSQKYSTMSPLGSGAFGFVWTAVDKEKNKEVVVKFIKKEKVLEDCWIEDPKLGKVTLEIAILSRVEHANIIKVLDIFENQGFFQLVMEKHGSGLDLFAFIDRHPRLDEPLASYIFRQLVSAVGYLRLKDIIHRDIKDENIVIAEDFTIKLIDFGSAAYLERGKLFYTFCGTIEYCAPEVLMGNPYRGPELEMWSLGVTLYTLVFEENPFCELEETVEAAIHPPYLVSKELMSLVSGLLQPVPERRTTLEKLVTDPWVTQPVNLADYTWEEVFRVNKPESGVLSAASLEMGNRSLSDVAQAQELCGGEGHHHHHH 335
           ~~~~~~~~|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
3dlsA  982 --------AVELEGLAACEGEYSQKYSTMSPLGSGAFGFVWTAVDKEKNKEVVVKFIKKEKVLEDCWIEDPKLGKVTLEIAILSRVEHANIIKVLDIFENQGFFQLVMEKHGSGLDLFAFIDRHPRLDEPLASYIFRQLVSAVGYLRLKDIIHRDIKDENIVIAEDFTIKLIDFGSAAYLERGKLFYTFCGTIEYCAPEVLMGNPYRGPELEMWSLGVTLYTLVFEENPFCELEETVEAAIHPPYLVSKELMSLVSGLLQPVPERRTTLEKLVTDPWVTQPVNLADYTWEEVF------------------------------------------ 1266

We suggest to evaluate this target as a single domain spanning whole chain. However, evolutionarily this is a 2-domain protein:

1st domain: target 9-110 ; pdb 982-1083

2nd domain: target 111-293 ; pdb 1084-1266

T0484    2k5k.pdb    T0484.pdb    PyMOL    PyMOL of domains    Target page

T0484    1 MRDMTEETRKDLPPEALRALAEAEERRRRAKALDLPKEIGGRNGPEPVRFGDWEKKGIAIDF 62
           ************||||||||||||||************************************
2k5kA    1 MRDMTEETRKDLPPEALRALAEAEERRRRAKALDLPKEIGGRNGPEPVRFGDWEKKGIAIDF 62

Residue change log: remove 1-MRDMTEETRKDL-12, 27-RRRAKALDLPKEIGGRNGPEPVRFGDWEKKGIAIDF-62 by 3.5Å SD cutoff;

Single domain protein: target 13-26 ; pdb 13-26

T0485    3dlc.pdb    T0485.pdb    PyMOL    PyMOL of domains    Target page

Residue change log: change 45 T to N; change 89 N to D; change 127 A to T; change 194 I to V; change 202 G to E; change 1, 16, 77, 162, MSE to MET; remove 0 G as it is not present in target sequence;

We suggest to evaluate this target as a single domain spanning whole chain. However, N-terminal segment extends away and may be removed, resulting in this domain definition:

1st domain: target 5-216 ; pdb 5-216

T0486    2vx2.pdb    T0486.pdb    PyMOL    PyMOL of domains    Target page

We suggest to evaluate this target as a single domain spanning whole chain. However, evolutionarily this is a 2-domain protein:

1st domain: target 32-230 ; pdb 45-243

2nd domain: target 231-287 ; pdb 244-300

T0487    3dlb.pdb    T0487.pdb    PyMOL    PyMOL of domains    Target page

T0487    1 MNHLGKTEVFLNRFALRPLNPEELRPWRLEVVLDPPPGREEVYPLLAQVARRAGGVTVRMGDGLASWSPPEVLVLEGTLARMGQTYAYRLYPKGRRPLDPKDPGERSVLSALARRLLQERLRRLEGVWVEGLAVYRREHARGPGWRVLGGAVLDLWVSDSGAFLLEVDPAYRILCEMSLEAWLAQGHPLPKRVRNAYDRRTWELLRLGEEDPKELPLPGGLSLLDYHASKGRLQGREGGRVAWVADPKDPRKPIPHLTGLLVPVLTLEDLHEEEGSLALSLPWEERRRRTREIASWIGRRLGLGTPEAVRAQAYRLSIPKLMGRRAVSKPADALRVGFYRAQETALALLRLDGAQGWPEFLRRALLRAFGASGASLRLHTLHAHPSQGLAFREALRKAKEEGVQAVLVLTPPMAWEDRNRLKALLLREGLPSQILNVPLREEERHRWENALLGLLAKAGLQVVALSGAYPAELAVGFDAGGRESFRFGGAACAVGGDGGHLLWTLPEAQAGERIPQEVVWDLLEETLWAFRRKAGRLPSRVLLLRDGRVPQDEFALALEALAREGIAYDLVSVRKSGGGRVYPVQGRLADGLYVPLEDKTFLLLTVHRDFRGTPRPLKLVHEAGDTPLEALAHQIFHLTRLYPASGFAFPRLPAPLHLADRLVKEVGRLGIRHLKEVDREKLFFV 685
           ~~||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
3dlbA    3 --HLGKTEVFLNRFALRPLNPEELRPWRLEVVLDPPPGREEVYPLLAQVARRAGGVTVRMGDGLASWSPPEVLVLEGTLARMGQTYAYRLYPKGRRPLDPKDPGERSVLSALARRLLQERLRRLEGVWVEGLAVYRREHARGPGWRVLGGAVLDLWVSDSGAFLLEVDPAYRILCEMSLEAWLAQGHPLPKRVRNAYDRRTWELLRLGEEDPKELPLPGGLSLLDYHASKGRLQGREGGRVAWVADPKDPRKPIPHLTGLLVPVLTLEDLHE---SLALSLPWEERRRRTREIASWIGRRLGLGTPEAVRAQAYRLSIPKLMGRRAVSKPADALRVGFYRAQETALALLRLDGAQGWPEFLRRALLRAFGASGASLRLHTLHAHPSQGLAFREALRKAKEEGVQAVLVLTPPMAWEDRNRLKALLLREGLPSQILNVPLREEERHRWENALLGLLAKAGLQVVALSGAYPAELAVGFDAGGRESFRFGGAACAVGGDGGHLLWTLPEAQAGERIPQEVVWDLLEETLWAFRRKAGRLPSRVLLLRDGRVPQDEFALALEALAREGIAYDLVSVRKSGGGRVYPVQGRLADGLYVPLEDKTFLLLTVHRDFRGTPRPLKLVHEAGDTPLEALAHQIFHLTRLY------------------------------------------- 642

5-domain protein, all domains used in evaluation:

1st domain: target 3-11, 310-318, 467-642 ; pdb 3-11, 310-318, 467-642

2nd domain: target 12-25, 97-176, 266-272, 276-309 ; pdb 12-25, 97-176, 266-272, 276-309

3rd domain: target 26-96 ; pdb 26-96

4th domain: target 177-265 ; pdb 177-265

5th domain: target 319-466 ; pdb 319-466

T0488    2vwr.pdb    T0488.pdb    PyMOL    PyMOL of domains    Target page

We suggest to evaluate this target as a single domain spanning whole chain. However, C-terminal segment of this structure protrudes away and interacts with the peptide-binding site of a symmetry mate. This segments (A:424-A:428) can be removed for domain-based evaluation, resulting this domain definition:

1st domain: target 1-90 ; pdb -1-423

T0489    3dl1.pdb    T0489.pdb    PyMOL    PyMOL of domains    Target page

Residue change log: change 18, 43, 71, 185, MSE to MET;

Single domain protein: target 17-98, 124-158, 161-253 ; pdb 17-98, 124-158, 161-253

T0490    3dme.pdb    T0490.pdb    PyMOL    PyMOL of domains    Target page

We suggest to evaluate this target as a single domain spanning whole chain. However, evolutionarily this is a 4-domain protein:

1st domain: target 3-49, 148-228, 318-368 ; pdb 3-49, 148-228, 318-368

2nd domain: target 50-88, 143-147 ; pdb 50-88, 143-147

3rd domain: target 89-142 ; pdb 89-142

4th domain: target 229-317 ; pdb 229-317

T0491    3dm4.pdb    T0491.pdb    PyMOL    PyMOL of domains    Target page

T0491    1 MNTLELSARVLECGAMRHTPAGLPALELLLVHESEVVEAGHPRRVELTISAVALGDLALLLADTPLGTEMQVQGFLAPARKDSVKVKLHLQQARRIAGSMGRDPLVGLEHHHHHH 115
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~~~~~~~~~~~
3dm4A    1 MNTLELSARVLECGAMRHTPAGLPALELLLVHESEVVEAGHPRRVELTISAVALGDLALLLADTPLGTEMQVQGFLAPARKDSVKVKLHLQQARRIAG----------------- 98

Residue change log: change 1, 16, 70, MSE to MET;

Single domain protein: target 1-98 ; pdb 1-98

T0492    2k5l.pdb    T0492.pdb    PyMOL    PyMOL of domains    Target page

T0492    1 MFSLRDAKCGQTVKVVKLHGTGALKRRIMDMGITRGCEIYIRKVAPLGDPIQINVRGYELSLRKSAAEMIEVE-------- 73
           |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~~
2k5lA    1 MFSLRDAKCGQTVKVVKLHGTGALKRRIMDMGITRGCEIYIRKVAPLGDPIQINVRGYELSLRKSAAEMIEVELEHHHHHH 81

Residue change log: remove 74-LEHHHHHH-81 as it is not present in target sequence;

Single domain protein: target 1-73 ; pdb 1-73

T0493    3dmn.pdb    T0493.pdb    PyMOL    PyMOL of domains    Target page

T0493    1 SNASY