T0519
PF11_0239 from unknown species
Target sequence:
>T0519 PF11_0239, unknown species, 180 residues
GISPNVLNNMKSYMKHSNIRNIIINIMAHELSVINNHIKYINELFYKLDTNHNGSLSHREIYTVLASVGIKKWDINRILQALDINDRGNITYTEFMAGCYRWKNIESTFLKAAFNKIDKDEDGYISKSDIVSLVHDKVLDNNDIDNFFLSVHSIKKGIPREHIINKISFQEFKDYMLSTF
HHsearch_pdb70_15May10, HHsearch_scop70_1.75, HHsearch_pfamA.24.0
Structure:
Determined by:
SGC
PDB ID:
canceled
Jmol of closest template of T0519: 3k21 chain A
Domains:
Structure classification:
The description below was written months before target structure release, thus it only presents shuoyong's personal thoughts simply based on sequence. Please be aware that it may contain laughable errors. It is certainly not our final assessment on this target. We will revise this section (and the sequence classification too) in a short time
Duplication. EF-hand fold, and onsists of two EF-hand units: each is made of two helices connected with calcium-binding loop.
CASP category:
Closest templates:
Template manually selected by shuoyong:
Template selected by HHpred server group:
Target sequence - PDB file inconsistencies:
Sequence classification:
This is more likely a calcium-dependent protein kinase (Calmodulin-like domain). The top two Pfam hits belong to SPARC_Ca_bdg (PF10591), which is Secreted protein acidic and rich in cysteine Ca binding region, and this family is a member of clan EF_hand (CL0220. The third Pfam hit is EF hand (PF00036). Note in pfam: Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand. This type of domain consists of a twelve residue loop flanked on both side by a twelve residue alpha-helical domain. In an EF-hand loop the calcium ion is coordinated in a pentagonal bipyramidal configuration.
All predictions:
TS (GDT_TS score), TR (GDT_TS with penalty [reference]