T0546
BvR159 from unknown species
Target sequence:
>T0546 BvR159, unknown species, 134 residues
MLKTILSIAGKPGLYKLISQGKNMLIVETVDAAKKRVPAYAHDKVISLADIAMYTDAEEVPLSEVLEAVKKKENGAVASINYKKASADELHAYFAEVLPNYDRDRVHNGDIKKLISWYNILVNNGITEFVEAPA
HHsearch_pdb70_15May10, HHsearch_scop70_1.75, HHsearch_pfamA.24.0
Structure:
Method: NMR
Determined by:
NESG
PDB ID:
canceled
No good template found for now, needs more study
Domains:
Structure classification:
The description below was written months before target structure release, thus it only presents shuoyong's personal thoughts simply based on sequence. Please be aware that it may contain laughable errors. It is certainly not our final assessment on this target. We will revise this section (and the sequence classification too) in a short time
medium hard target?. The N-terminal around 1-53 is dificult to predict. The rest part is multihelical. some similarity to
CASP category:
Closest templates:
Template manually selected by shuoyong:
No good template found for now, needs more study
Template selected by HHpred server group:
Target sequence - PDB file inconsistencies:
Sequence classification:
No significant hit. N-terminal(3-43) may be Domain of unknown function (DUF1859) (PF08948), C-terminal (59-127) may be Protein of unknown function (DUF1198) (PF06711).
All predictions:
TS (GDT_TS score), TR (GDT_TS with penalty [reference]